ask frosty

lol so a lot of people have questions and some people even asked for this page so here it is! ask anything you want and ill try to answer it if i have time. but before you comment please check my site because most of your answers can be found on it (:

~frosty

1,321 Comments Add your own

  • 1. ydoggy  |  July 27, 2008 at 11: 19 am

    Wats the easist way to make lots of coins?

    And did you get your site so famous?

  • 2. frosty  |  July 27, 2008 at 11: 19 am

    1. combo drop
    and 2. i have no idea

  • 3. X_BlueNote_X  |  July 27, 2008 at 12: 06 pm

    Hey Frosty!,

    What Server Are you usually on when you go online?

  • 4. Fluffy  |  July 27, 2008 at 12: 12 pm

    Did u copy me? lol or was this already here? :lol:

  • 5. Fiona617384  |  July 27, 2008 at 1: 29 pm

    What do you have to do to become one of your “workers”?

  • 6. frosty  |  July 27, 2008 at 1: 37 pm

    i usually go on wobbly
    fluffy i put it on at liek the exact same time as u lol
    and u have to eb my friend to be my worker and have a wordpress but uhhhm i cant have no more

  • 7. ydoggy  |  July 27, 2008 at 1: 39 pm

    frosty are u an alien if u know any aliens or super hyper ppl tell me?!

  • 8. ch0c0late  |  July 27, 2008 at 1: 46 pm

    CAN I MEET U ON DIZZYWOOD?! PLZPLZPLZPLZ
    (ya i know im a weirdo sry bout that)

  • 9. ch0c0late  |  July 27, 2008 at 1: 47 pm

    What do u have to do to be ‘ready’ to go into professor plumplox’s lair?

  • 10. ch0c0late  |  July 27, 2008 at 1: 47 pm

    wuts up with the pics?

  • 11. frosty  |  July 27, 2008 at 1: 50 pm

    lol omg ok
    yes i am an alien and im super hyper MUAHAHAHA
    ill meet u on dw just say when
    and u need to complete the games like in ur backpack to be ready or whatever and uhmz what pics XD

  • 12. Horsecrazy11  |  July 27, 2008 at 2: 07 pm

    can u do the blocks on breakwater beach for me

  • 13. ch0c0late  |  July 27, 2008 at 2: 08 pm

    FROSTY! R U THERE!!

  • 14. ch0c0late  |  July 27, 2008 at 2: 09 pm

    CAN U MEET ME ON WOBBLY AT PRESTOS GROVE? NOW?

  • 15. ch0c0late  |  July 27, 2008 at 2: 41 pm

    whaaaa! frosty didnt meet me whaaa!

  • 16. Pinaydog07  |  July 27, 2008 at 3: 46 pm

    hey frosty why don’t u check ym site sometime so i can give you ideas for your blog. will you check most of the time please. Thanks frosty

  • 17. cccc  |  July 27, 2008 at 3: 47 pm

    hey frosty some1 told me that u r really i guy, but i didn’t believe them is it true?

  • 18. frosty  |  July 27, 2008 at 3: 56 pm

    lol im pretty sure im not a guy

  • 19. cccc  |  July 27, 2008 at 3: 57 pm

    i new it i just wanted 2 prove the person wrong

  • 20. cccc  |  July 27, 2008 at 4: 30 pm

    do u know all the people on ur bestest buddE’s list in real life?

  • 21. doggywoods  |  July 27, 2008 at 5: 25 pm

    did you know that you could go to the mine now?
    you need a mining helmet
    and some light
    oh great site

  • 22. thao  |  July 27, 2008 at 5: 46 pm

    HELP ME!!!! well i saw you today but you woulnt aswer my question so here it is how do you get in the Tau Parsnip its in the mine i try everything but it kept saiding “The room is too dangerous!” So i cant get in! plz plz find a way to get in

  • 23. thao  |  July 27, 2008 at 5: 50 pm

    o and what the fastest way to get $$$$$ (money) in dizzywood im getting tired of playing games so find a new way to get $$$$ plz plz plz

  • 24. Utoipia  |  July 27, 2008 at 6: 16 pm

    Hi umm i met you on dizzywood and i love your sites my names utoipia on dizzywood do you want to be friends cus you are the smartest dizzian i knopw and i really wanna be friends with you im on right now so accept me PLEASE

  • 25. smileymiley484939  |  July 27, 2008 at 6: 23 pm

    Frosty Please have all you friends click on my Dragon eggs
    They need it to survive and hatch
    Thanx

    http://dragcave.ath.cx/user/smileymiley48493

    http://dragcave.ath.cx/user/smileymiley484939

  • 26. xxboohxx  |  July 27, 2008 at 7: 43 pm

    frosty…what color are my underwear?

  • 27. frosty  |  July 27, 2008 at 7: 44 pm

    purple with flowers

  • 28. ;s;s;;s  |  July 27, 2008 at 7: 59 pm

    frosty do u know all the people on ur bestest buddE’s list in real life?

  • 29. frosty  |  July 27, 2008 at 8: 00 pm

    no only blucky

  • 30. ;s;s;;s  |  July 27, 2008 at 8: 02 pm

    oh thanks 4 answering my question

  • 31. sereney  |  July 27, 2008 at 11: 51 pm

    FROSTY WHATS 300 X 500 9 ITS A QUESTION ON A QUIZ) LOL

  • 32. SPORTY1418  |  July 28, 2008 at 12: 54 am

    HEY CAN I BE YOUR BESTEST BUDY TO I LUV YOUR SITE AND IM REALLY BORD

  • 33. marshmellowmonster  |  July 28, 2008 at 1: 18 am

    hey frosty cand i “work” for you

  • 34. googly_eye415  |  July 28, 2008 at 1: 24 am

    where do you get piglet and the floating fish

  • 35. marshmellowmonster  |  July 28, 2008 at 1: 45 am

    o and btw i starting my own blog well iv started it but i didnt right andthing yat

  • 36. emily  |  July 28, 2008 at 3: 14 am

    im where do you get the skate wheels

  • 37. hazem  |  July 28, 2008 at 5: 23 am

    where is the piglet please plz plz plz answer

  • 38. frosty  |  July 28, 2008 at 9: 12 am

    sereny- i have no friggen idea
    sporty- uhm
    marshmellowmonster- well i cant have any more workers and i dont hire people i dont know. cute name btw XD
    googly_eye415- you get them from the snake in explorers camp
    emily- classic question :) well there’s 1 in prestos grove, 2 in prestos edge, and 1 in tanglevine, there mostly behidn stuff like tree’s
    hazem- talk to the snake!

  • 39. 1ynop  |  July 28, 2008 at 10: 50 am

    frosty can u be a worker on my blog pleease
    ~lemmonade9

  • 40. frosty  |  July 28, 2008 at 10: 53 am

    uhmz i dont know u THAT well

  • 41. Sunshine1416  |  July 28, 2008 at 12: 49 pm

    I know this sounds weird but can u met me on dizzywood i wanna be friends with u. Just tell me a time thatss good 4 u. kk :P

  • 42. craziiiomgiii  |  July 28, 2008 at 1: 01 pm

    yo … i just met you on dizzywood and you really didn’t talk to me that much except i think u just said lol..n stuffz.soo just wanted to ask you an important question.
    ~the hair stylling and coloring game is pretty hard.so are there any other ways to get the power..or any hints or..umm “an easier way”?
    ps:answer soon!

  • 43. I ROCK THE WORLD  |  July 28, 2008 at 1: 16 pm

    hey frosty, my Question is “How do you make a cheat website (like yours) and how do you get so famouse? Thanks from I ROCK THE WORLD

  • 44. cupcake_5345  |  July 28, 2008 at 1: 47 pm

    how do i get the twinklepig??

  • 45. cupcake_5345  |  July 28, 2008 at 1: 54 pm

    plz plz plz

  • 46. cupcake_5345  |  July 28, 2008 at 1: 56 pm

    plz awnser me

  • 47. frosty  |  July 28, 2008 at 1: 58 pm

    sunshine- i can go on anytime you want
    craziiomgiii- there’s no other way to get the powers, and i know i dont talk much on dizzywood lol
    i rock the world- you make a cheat website on sites like wordpress, piczo or ty. and um.. im not famous argh
    cupcake- you used tog et the twinkelpig from an event but now you can get it from the Mines

  • 48. Blonstey  |  July 28, 2008 at 2: 00 pm

    Hey Frosty its me again, just wanted to ask you something. Do you live in Canada or U.S.A?

  • 49. frosty  |  July 28, 2008 at 2: 01 pm

    usa lol

  • 50. cupcake_5345  |  July 28, 2008 at 2: 02 pm

    where in the mines

  • 51. cupcake_5345  |  July 28, 2008 at 2: 03 pm

    me too

  • 52. frosty  |  July 28, 2008 at 2: 04 pm

    at the end of the MInes in that room its over the pot thingy…mabobber

  • 53. cupcake_5345  |  July 28, 2008 at 2: 07 pm

    ok thnx

  • 54. megan  |  July 28, 2008 at 2: 22 pm

    dcfdfcdffgfgffdd

  • 55. redflame1502  |  July 28, 2008 at 2: 29 pm

    how do u get threw the rock maze

  • 56. cici123123  |  July 28, 2008 at 2: 29 pm

    Frosty wen i was in the mines the other day i saw a piece of a garden statue behind a drill i looked everywhere else but i couldnt find the rest . did u find all of them ? can u tell us where? when u find them all do u get a nother critter? plz tell me the answers ! im waiting on u ! thx Cynthia

  • 57. frosty  |  July 28, 2008 at 2: 35 pm

    cici it must have been a glitch and redflame u figuere out what way to go and make it to the finish

  • 58. Flower96  |  July 28, 2008 at 2: 56 pm

    Hey how do u get a flutterbird??

  • 59. fluffers1490  |  July 28, 2008 at 4: 40 pm

    I don’t think it was a glitch frosty, I keep seeing it too.

  • 60. Looky  |  July 28, 2008 at 4: 52 pm

    Hey frosty, Ima fan! Uh, do you think you could post the url gossipblog.weebly.com somewhere on your blog so we can get more visits? cough cough its not doin soo well….

    -looky :)
    thanks

  • 61. thinkpink1331  |  July 28, 2008 at 6: 51 pm

    how can i color peoples hair? it sounds like fun!

  • 62. thinkpink1331  |  July 28, 2008 at 6: 53 pm

    oh also how do i get the idol thingy i have that gosty power but i can not find the idol thx!

  • 63. frogster11  |  July 28, 2008 at 7: 12 pm

    how can you become a worker ? id like to help! i always love to go on dizzywood

  • 64. Lillyavatar767  |  July 28, 2008 at 8: 37 pm

    Hey frosty uh i was just wondering,
    1 does it ever get tiring answering so many questions and having so many fans?
    2 why cant u hav any more workers?

  • 65. Dizzypuppy1234  |  July 28, 2008 at 8: 44 pm

    Hey Frosty! Luv ur web! Can u do me a favor? Can u do the DA (Dizzy Activaty) “Ugh, sometin Somtin” Plz! Just after u do dont use nemore!

  • 66. frosty  |  July 28, 2008 at 8: 47 pm

    ugh i DID do it but some hacker DELETED it

  • 67. calmightytwin  |  July 28, 2008 at 10: 13 pm

    hi ummm
    is waddelz a twin with lovley cuz im a twin

  • 68. SPORTY1418  |  July 28, 2008 at 10: 16 pm

    hey frosty r u on i want to meet u please u seem cool

  • 69. 1ynop  |  July 28, 2008 at 10: 18 pm

    then can i meet u on dizzywood so u can get to no me better
    ~lemmonade9

  • 70. marshmellowmonster  |  July 28, 2008 at 11: 08 pm

    HACKER?

  • 71. marshmellowmonster  |  July 28, 2008 at 11: 10 pm

    WAT?

  • 72. SPORTY1418  |  July 29, 2008 at 12: 32 am

    hey whats up

  • 73. tarek  |  July 29, 2008 at 1: 39 am

    can any one tell me where is the floating fish plz plz plz answer

  • 74. JazzGal  |  July 29, 2008 at 1: 56 am

    hey um i want to be ur worker on this web if u say yes or no plz meet me on wobbly today if u get it today

  • 75. 1ynop  |  July 29, 2008 at 5: 25 am

    uh u needed to no me better so uhh…
    my faveroite color is blue my name on dizzywood is lemmonade9 i am a beta tester my faveroite food is uh cookies i know the awnser to evrey riddle in presto’s edge, ive been playing dizzywood for 1 year and 7 months i have seen you on dizzywood 10 times and im usaly on groggy and wobbly
    ~lemmonade9

  • 76. tarek  |  July 29, 2008 at 5: 39 am

    plz answer my question

  • 77. cici123123  |  July 29, 2008 at 6: 54 am

    no the garden statue wasnt a glitch i found it behind the drill in the crystal corrupt place so plz give me more answers thx frosty!

  • 78. wittywood599  |  July 29, 2008 at 8: 09 am

    are u my best friend?

  • 79. Lillyavatar767  |  July 29, 2008 at 11: 02 am

    Frosty why cant u hav any more workers?

  • 80. bftuna  |  July 29, 2008 at 11: 24 am

    NO IM HER BESTEST FRIEND EVA! no not really

  • 81. Blonstey  |  July 29, 2008 at 11: 24 am

    lol, I live in Canada!

  • 82. Blonstey  |  July 29, 2008 at 11: 25 am

    P.S. I saw you!

  • 83. craziiiomgiii  |  July 29, 2008 at 12: 04 pm

    eyy…frosty thanx 4 answering my question…anywaiiiz
    ..if i run out of zap wat am i sopposed to do?

  • 84. kcb41044  |  July 29, 2008 at 12: 05 pm

    i put my friend code and user on that page.. and uhhh,, it is not there any more… so i put it on again last night and it disappeared again!

    is it u doing this or sombody else??

    r u mad at me? 4 some reason?

  • 85. Kity24  |  July 29, 2008 at 12: 35 pm

    Can you adverise my friend code? it’s ball410

  • 86. rule_cnc34  |  July 29, 2008 at 1: 19 pm

    how do you get a website?

  • 87. Dizzypuppy1234  |  July 29, 2008 at 1: 43 pm

    Hey Frosty its me again! So can u do the activaty for me? Ill give u my password

  • 88. Sunshine1416  |  July 29, 2008 at 3: 05 pm

    kk maybewe can met on dw today or tommarow whenever u got the time

  • 89. Sunshine1416  |  July 29, 2008 at 3: 06 pm

    sorry i spelt maybe wrong

  • 90. Queen club  |  July 29, 2008 at 5: 01 pm

    can you gve me the link to your clubpenguin cheat thingy plz

  • 91. awesomed  |  July 29, 2008 at 8: 32 pm

    Ok how do u put your workers name on the workers list plz tell me pplz

  • 92. penguins rule 33  |  July 29, 2008 at 8: 41 pm

    how do u get the minning helmet

  • 93. mickymon  |  July 29, 2008 at 9: 03 pm

    Hi Frosty,
    How do u get a turtlebug? And where r the other four statue pieces in the main mine as I can only find one.
    Help me Im stuck in the mine?????

  • 94. frosty  |  July 29, 2008 at 9: 07 pm

    you get the mineing helmet from crystal catacombs its just like lieing there on the ground,
    and you get a turtlebug form getting 15 (i had to get 25.. ) people to use your friendcode
    ive never seen the statue pieces either

  • 95. mickymon  |  July 29, 2008 at 9: 12 pm

    You use yr ghostray on the big drill and I found one piece

  • 96. Sunshine1416  |  July 29, 2008 at 9: 16 pm

    what server should we met on? tomarrow aka wednesday

  • 97. SPORTY1418  |  July 29, 2008 at 11: 07 pm

    HEY UHMMMMMMMMMMMM FROSTY Y ARENT U ANSWERING MY QUESTIONS?????????????????

  • 98. lexiegab  |  July 30, 2008 at 12: 49 am

    anyone on?
    i was wondering how do you style other people’s hair

  • 99. XxBoohxX  |  July 30, 2008 at 3: 07 am

    hey frost i met a girl called JazzGal on dizzywood and she said shes your biggest fan and that she has this website on her fav list i meen thats cool fan of urs and she said she would love to see u in person. so do u have the time tommorrow afternoon she said about 5:30

  • 100. XxBoohxX  |  July 30, 2008 at 3: 08 am

    she wants to meet u on wobbly

  • 101. TwilightStars (name is dizzywood)  |  July 30, 2008 at 3: 24 am

    How many coins do you need to make a crystal critter real? and if you got like…a bunnycorn and a fox (fox from the mine in dizzywood) then which one does it choose first to make real?

  • 102. wittywood599  |  July 30, 2008 at 6: 57 am

    frosty why are u not answering my questions

  • 103. wittywood599  |  July 30, 2008 at 6: 57 am

    youre blog rules

  • 104. ilv123  |  July 30, 2008 at 8: 28 am

    hi frosty! i really like this site. how do u make a site? do u have to pay? well i wanna ask u- where can you find different accesories? can we meet on sunday on the wobbly server abot afternoon!at pestros grove ! thanx

    ilvija (ilv123-dizzywood account)

  • 105. horse345  |  July 30, 2008 at 9: 37 am

    how did u become famous on dizzywood

  • 106. Dizzypuppy1234  |  July 30, 2008 at 11: 13 am

    So Frosty Plz can u do my activaty? If u cant its ok

  • 107. cheezit4  |  July 30, 2008 at 11: 57 am

    i know i must sound really slow right now, but how do u get the zapping power?! im too lazy to try and look on the rest of the site for th answer. plz help!!!

  • 108. frosty  |  July 30, 2008 at 11: 59 am

    ok it takes logn to explain so jsut find a pathfinder on dizzywood and ask them to drop a how to get zap power guide for you

  • 109. cheezit4  |  July 30, 2008 at 12: 01 pm

    wow u answered fast! thx! and this is random but r u a magician??lol u don’t need to answer that

  • 110. frosty  |  July 30, 2008 at 12: 03 pm

    ………

  • 111. cheezit4  |  July 30, 2008 at 12: 04 pm

    wait!!i almost forgot! wat does a pathfinder look like?! i just started dizzywood like 2 days ago so im like clueless!!

  • 112. cheezit4  |  July 30, 2008 at 12: 13 pm

    nvm, i got it

  • 113. neef  |  July 30, 2008 at 1: 08 pm

    how do i make a real pet

  • 114. Blonstey  |  July 30, 2008 at 1: 17 pm

    frosty PLZ don’t leave you’re site!!!!!

  • 115. mizcool123  |  July 30, 2008 at 2: 31 pm

    frosty i tried to add you as one of my friends and you didnt accept it :( :( :( :( :( :(
    So Sad

  • 116. Anonymous  |  July 30, 2008 at 5: 11 pm

    hi

  • 117. ducksrock111  |  July 30, 2008 at 5: 44 pm

    how do u become a agent?

  • 118. Sophia  |  July 30, 2008 at 8: 42 pm

    wheres the 3rd piece to the dmpener

  • 119. bigfrostyfan  |  July 30, 2008 at 8: 58 pm

    hey frosty, where is professor plumox’s lair?? i mean, i passed all the challenges but i cant find where it is…

    everyone luvs you,
    -Maddie
    ps. i know you say no to almost everyone but i was wondering if we could meet on dizzywood stupid question rite? you probly get that question asked a lot! BYE

  • 120. SPORTY1418  |  July 30, 2008 at 9: 05 pm

    FROSTY I REALLY WANT TO MEET U DONT LEAVE YOU R U COOL PLEASE DONT LEAVE

  • 121. Pinaydog07  |  July 31, 2008 at 1: 03 am

    hi frosty can u visit my site please its pinaydog07.wordpress.com please come and visit and comment please please i will really appresciate it. ;) :) will you visit it sometimes when you have time?? please answer my question. ok thanks for reading :)
    pinaydog07.wordpress.com

  • 122. tootsie888  |  July 31, 2008 at 1: 22 am

    i went to someones room to talk and all i said was what do you like to do in the game and i liked rock and roll and i liked m and m {short for eimenem} and the kicked me out of the game what the hell is that all about i guess you can not talk to anyone or they will suspend you what a f—– up game

  • 123. lmno  |  July 31, 2008 at 1: 35 am

    hey frosty u cool,were do u get a double headed snake?look at my happy/daed face \,,/(+_+)\,,/.lol

  • 124. missjaay30  |  July 31, 2008 at 1: 49 am

    Your leaving? Uh btw, are you thinking of having an affie system?

  • 125. popstar3000  |  July 31, 2008 at 2: 25 am

    Its raining in dizzywood and I went to the cloud sprite in Skytown to awnser the questions but I cant get them right. What are the awnsers to the questions?

  • 126. anonymous  |  July 31, 2008 at 2: 59 am

    how do you register on dizzywood? wheneva i press play now all it says is login

  • 127. gotchi  |  July 31, 2008 at 3: 13 am

    can i PLZ work here

  • 128. Crysatal97  |  July 31, 2008 at 3: 40 am

    What is u fav colour, why?

  • 129. JazzGal  |  July 31, 2008 at 5: 15 am

    wat are the answers for the um quiz up in sky town skate park

  • 130. wittywood599  |  July 31, 2008 at 6: 25 am

    pls answer

  • 131. neef  |  July 31, 2008 at 6: 31 am

    frosty how do i make a real pet?

  • 132. ilv123  |  July 31, 2008 at 6: 33 am

    in wildwood glen… how do u get to the tree house??? it sais u need to find something but what? plz help

  • 133. Johnelle  |  July 31, 2008 at 7: 26 am

    hey frosty plss answer how can i get a bunnycorn

  • 134. dizzywood fan  |  July 31, 2008 at 7: 33 am

    hi frosty
    how do u get through the keepout signs
    plz tell me!!!!
    from dizzywood fan

  • 135. ilv123  |  July 31, 2008 at 8: 08 am

    Everyone! On August 3rd, 2008, the Giddy Server someone or dizzywood will be holding a “Sun and Moon Tide Festival”! ! It will be held in Tanglevine Jungle at exactly 4:00pm until 5:00pm. Wear any jungle/Tanglevine Jungle clothes you own to the festival. There will be fireworks, dancing, and more!

    so im coming! everyone and frosty plz come so it will be more fun with more people!

    i think its us time… or i dont know coz im in england so itll b hard for me!

    ilv123

  • 136. ilv123  |  July 31, 2008 at 8: 09 am

    oh and is there any other way than a friendcode to get the turtlebug critter??? thx

  • 137. ilv123  |  July 31, 2008 at 8: 11 am

    im making a dizzywood cheat site aswell!!! ill tell u guys when its ready!

  • 138. ilv123  |  July 31, 2008 at 8: 15 am

    here is a freaky wierd song!

    dont close your eyes, dont fade away… dont leve me here like this
    i love you… you know it… then please dont leave me!
    stay awake, dont go away, for i love you
    dont let me be alone, coz
    I CANT LIVE…. I CANT LIVE HERE WITHOUT Uuuuuuu
    LA LA LA LA LA LA,,,,, LA LA LA LA LA
    I CANT LIVE …..I CANT LIVE HERE WITHOUT Uuuuuu

    dont leave… me please… dont close your eyes
    stay awake for meeeeeeeeeeeeeeeee,
    because
    I CANT LIVE…… I CANT LIVE HERE WITHOUT Uuuuuuuuu
    DONT LEVE FOR I CANT LIVEEEEEE

    i loooooooooooove youuuuuuuuuuuu

    freaky init!

  • 139. plz help  |  July 31, 2008 at 10: 28 am

    what do u have to use ghostray on to get the opal idol???

  • 140. frosty  |  July 31, 2008 at 10: 29 am

    ghostray all the little ruins around you and you’ll find it

  • 141. plz help  |  July 31, 2008 at 10: 43 am

    kk, thnx =)

  • 142. plz help  |  July 31, 2008 at 10: 46 am

    wait sry, wat happens now that u find it?

  • 143. frosty  |  July 31, 2008 at 10: 49 am

    u can get zap with ti after u get the other one under the rock pile in jaguar temple

  • 144. plz help  |  July 31, 2008 at 10: 50 am

    woot thank u!!

  • 145. cheezit4  |  July 31, 2008 at 12: 55 pm

    hey u know how the person said they saw a piece of a statue or something in the mine? well it wasn’t a glitch. in the omega beet mine if u use ghostray on this machine on the upper left, u get another piece of the statue.

  • 146. puppy_wuver  |  July 31, 2008 at 1: 22 pm

    ok so this is my dads e-mail sorry i dont hav one yet! frosty wanna meet me sonetime in dizzywood? i saw u the other day and i was wonderin if u wanted 2 chat…does august 1 at 12:00 sound good? please respond! my username is puppy_wuver and u might reconize me as the girl asking u: how is it like bein famous frosty? lol i was so excited 2 see u i got a lil hiper their! lolz! well see ya! PUPPY_WUVER

  • 147. kutie219  |  July 31, 2008 at 2: 01 pm

    hey frosty do u know how to get in the tree house [:

  • 148. riki101  |  July 31, 2008 at 2: 36 pm

    how do you get up the tree!

  • 149. frosty  |  July 31, 2008 at 2: 38 pm

    u cant….

  • 150. dizzywood fan  |  July 31, 2008 at 3: 32 pm

    how do u get in the treehouse?????

  • 151. Dizzypuppy1234  |  July 31, 2008 at 3: 47 pm

    HELP ME PLZ! ILL GIVE U MY PASSWORD TO DO IT FOR ME!!!!!
    o n how do u get to the birdhouse or wateva

  • 152. 1998v  |  July 31, 2008 at 4: 07 pm

    where do u get a bunnycorn frosty plz awnser me i think u sound cool

  • 153. 1998v  |  July 31, 2008 at 4: 09 pm

    and how do u get up the tree house in the new wildwood glen

  • 154. 1998v  |  July 31, 2008 at 4: 10 pm

    plz plz plz plz [plz plz pl awnser im a girl too u now

  • 155. 1998v  |  July 31, 2008 at 4: 12 pm

    how do u get a bunnycorn
    frosty plz awnser me i now u r nice
    (i hope but u should be cuz u awnsered a lot already)

  • 156. 1998v  |  July 31, 2008 at 4: 13 pm

    and how do u get a twin
    and where is elvis

  • 157. 1998v  |  July 31, 2008 at 4: 15 pm

    i now iv got a lot to ask soz but still plz awnser

  • 158. funny girl  |  July 31, 2008 at 4: 24 pm

    frosty.. on my site i copied some of your pics coz i find your dizzywood avatar cute!

  • 159. frosty  |  July 31, 2008 at 4: 40 pm

    alright u get a bunnycorn from collecting the blue crystals in jaguar temple then talkign to the snake in the camp. and u cant get in the treehouse yet. uhhhhm plz dont copy things from my site either ok byez

  • 160. agent  |  July 31, 2008 at 4: 54 pm

    what treehouse

  • 161. lucky_7  |  July 31, 2008 at 5: 46 pm

    how do u get in the tree house?

  • 162. :?  |  July 31, 2008 at 7: 34 pm

    how do u get the double snake?

  • 163. sereney  |  July 31, 2008 at 8: 39 pm

    you can’t get into the tree house look 0on post149

  • 164. CrazyMay  |  July 31, 2008 at 9: 17 pm

    Hi!!Frosty can you tell us the answers for the Pathfinder test please and that you rule in dizzywood.com!!!!!!!!!!!!!!!!!!!!!!!!!!!

  • 165. CrazyMay  |  July 31, 2008 at 9: 19 pm

    Frosty can you tell me how do go up in the tree house bye!!!!!!!

  • 166. Queen club  |  July 31, 2008 at 9: 33 pm

    were are all the watermelon pieses

  • 167. Queen club  |  July 31, 2008 at 9: 33 pm

    and im aculaly lkvs in dizzywood AND THE FIRST LETTER IS A L

  • 168. Queen club  |  July 31, 2008 at 9: 34 pm

    K im ussally on snazzy k

  • 169. brittany  |  July 31, 2008 at 10: 10 pm

    Hey um when you spy eye some one do they know you have spy eye on them??

  • 170. suhayb hussein  |  August 1, 2008 at 1: 57 am

    how get to the tree house?

  • 171. JazzGal  |  August 1, 2008 at 2: 14 am

    hey um frosty if u answer this or any ove ur workers idc but how can i become one of ur workers il send u a pic of me on dizzywood. il do anything ((execpt go to were u live )) to be a worker. plz. im not picky i just want to be a worker so plz answer me if u get a chance to

  • 172. cooldude_626  |  August 1, 2008 at 3: 23 am

    Hey frosty!!!!! Where do you get ghost ray?

  • 173. Mozinewbe  |  August 1, 2008 at 3: 43 am

    hey frosty

    how do you get the zaps so you can go to sky town????? xoxoxo > <

  • 174. Raised  |  August 1, 2008 at 4: 27 am

    Hey Frosty,

    I was wondering if you could tell me how to get my levitation
    power?

    …Raised-Im a girl lol

    P.S: Dont rush to answer, i can wait. Thanks a bunch.
    : ) : ) : )

  • 175. Anonymous  |  August 1, 2008 at 4: 47 am

    how do you g

  • 176. I ROCK THE WORLD  |  August 1, 2008 at 5: 48 am

    hey frosty,what wordpress webhost did you use for your website?

  • 177. 1998v  |  August 1, 2008 at 7: 24 am

    how do u streak hair
    frosty and sorry i had to ask u …………agian

  • 178. hayleymad64  |  August 1, 2008 at 2: 11 pm

    hello i was wondering how u get the two headed snake?

  • 179. jsz1998  |  August 1, 2008 at 3: 34 pm

    wheres the watermelon,i can’t find it!?!?!?!

  • 180. uurika  |  August 1, 2008 at 3: 41 pm

    how do you get to the tree house

  • 181. csmamag  |  August 1, 2008 at 4: 10 pm

    Frosty?
    I REALLY wanna be ur friend. how do i ask? or u can ask me lol
    omg ive been looking on ur web every day since u posted that thing with the surprise party on it.
    i think it would be AWESOME to be a worker and omg i am not a hacker. ask anybody. lol ill take a lie dectector test and an interview. if i did ( i wont ) u have permission to report my dizzywood account a million times, her name is Metallic_Blue
    So like, i will not erase any posts, bc i know how hard it is to make them. lol ive only made one. i wanna be a writer bc i love helping ppl and it is fun :)
    i go on dizzywood every day and i am really good, so i can help with the daily events and stuff. i will check the explorers journal and post any new articles on it. please frosty :)
    omg i am SUCH a big fan i really want to meet on there how about tomorrow on wobbly in prestos grove at 1:00 p.m. PST?
    idk wat time it is for like central time. Please Frosty i have been checking ur site since u said u wernt quitting with the suprise party and stuff.
    i will go on every day if u want to help and do watever u need.
    Please Frosty, I have been dreaming of working and writing for u since that time. i am a really big fan and u are so awesome to me :)
    omg this is a long post oops lol sorry :)
    Please? I really want to.
    Thanks,
    Metallic_Blue on Dizzywood.

  • 182. lmno  |  August 1, 2008 at 7: 10 pm

    chech out my site it aint that good yet but im gonna have cheats i think!!!! http://www.myplace00.blinkz.com by the way frosty if ur site was free to make it and publish it tell me wat it is plzz!like is it blinkz,synthasite or something?\,,/(+_+)\,,/ hehe haha ;]

  • 183. Sascha  |  August 1, 2008 at 7: 15 pm

    how do you become a pathfinder?

  • 184. Sascha  |  August 1, 2008 at 7: 16 pm

    drxgjfydjrd dfhnndherfd jerfhfuhvrtuhnrternj dfjkdfnjhdfdfnhddfnh efansdfjhdnfn edbnsdfndg rgtdrhnnfgjf rtjhdfkdfkdfkdfkdfkdfkdfkdfkdfkdfkcgndgthgthng rgrgrgrgrgrgrgrgrgrgrgrgrghfjfjdksdkdkcdksdksdsdj djdfjfjvfgjffnfdnndfjfdjfjfjrdjfgtkrtjtjrhrjgtjtgmhscnsvcdrsnhncfdsfc srd

  • 185. Comfycushion1203  |  August 1, 2008 at 7: 42 pm

    Hey! I was wondering, how can you get to the keep out places? Please answer soon!

    -comfycushion1203

  • 186. aly_jr  |  August 1, 2008 at 8: 27 pm

    Whenever my friend makes an account cuz i invited her it doesnt work..why?

  • 187. rock0ut  |  August 1, 2008 at 8: 56 pm

    Hi Frosty. I hoped not to become one of the annoying question-ish ppl on your site, but this is drivin me crazy- the big blue crystals in the jaguar cave have disappeared, idk if it’s happened to everyone or just me, but now im not sure how to get the two-headed snake and that bird critter. kk ily ^_^

  • 188. RainbowMagic  |  August 2, 2008 at 3: 46 am

    Sorry i posted in about me :p
    where is the third peice of dapender?

    thanks

  • 189. aabaa  |  August 2, 2008 at 3: 48 am

    when u get the magic box,what do they mean by u can only open it at the party?

  • 190. Johnelle  |  August 2, 2008 at 4: 13 am

    frosty! plss tell me how can i get a bunnycorn and spyglass emote plsss answer me ASAP

  • 191. neef  |  August 2, 2008 at 8: 41 am

    hi frosty can you tell me how to get a pet pls pls

  • 192. vinj_garcia  |  August 2, 2008 at 10: 49 am

    rock0ut the blue crystals is gone now you can only have the new critters in the mine

  • 193. vinj_garcia  |  August 2, 2008 at 10: 50 am

    aly_jr i know its truth but i dont know why its that like me my friends making an account using my friend code but my invited friends is still 0

  • 194. vinj_garcia  |  August 2, 2008 at 10: 52 am

    Metallic Blue you cant be a author now like me i cant said frosty and other now cant

  • 195. vinj_garcia  |  August 2, 2008 at 10: 53 am

    frosty can u change the name in this post can you change it to “ask frosty and vinjgarcia” pls.?

  • 196. vinj_garcia  |  August 2, 2008 at 10: 54 am

    the watermelon is on the garden gazebo ghostray all the poles in allykatz building or house or wateva

  • 197. frosty  |  August 2, 2008 at 12: 26 pm

    ill answer any Qustion

  • 198. Ruth  |  August 2, 2008 at 3: 15 pm

    Hi! I’m from DizzyWood live. I need more cheats to dizzywood! Oh and how do i become one of your workers?

  • 199. Ruth  |  August 2, 2008 at 3: 17 pm

    Frost how do u get to the rats lair?

  • 200. frosty  |  August 2, 2008 at 3: 40 pm

    i wont be accepting anymore workers..arghhh sorry!
    :{{

  • 201. coolgirl  |  August 2, 2008 at 4: 39 pm

    hey frosty, when u go in the onkasi treasure room, doesn’t it take a long time to open, i mean i went in there and i got almost all the items, but i mean dont you think it takes such a long time??? i just wish there was a glitch on that thing.

  • 202. lola  |  August 2, 2008 at 6: 36 pm

    who is the most evil guy in dizzywood

  • 203. PiiNKYTOE  |  August 2, 2008 at 6: 42 pm

    hey frosty

  • 204. dizzywood1  |  August 3, 2008 at 12: 19 am

    hi i was wondering how you put the chatbox in the catagories

  • 205. __Sakura__  |  August 3, 2008 at 1: 57 am

    frosty do u know how to get up to the tree house

  • 206. JazzGal  |  August 3, 2008 at 2: 40 am

    omg number 200 frosty it aint really you cos it aint green

  • 207. vinj_garcia  |  August 3, 2008 at 7: 45 am

    frosty can i answer questions too?
    pls.?

  • 208. Anonymous  |  August 3, 2008 at 7: 46 am

    how you get in tree house

  • 209. eleany  |  August 3, 2008 at 9: 49 am

    how do u get a skate board

  • 210. chandni  |  August 3, 2008 at 11: 39 am

    how do you get the cake fast enough

  • 211. surry  |  August 3, 2008 at 11: 40 am

    how do you get the cake fast enough

  • 212. surry  |  August 3, 2008 at 11: 42 am

    you can get a skate board fro the mystery wagon or a secret envelpole

  • 213. 11grilsrr  |  August 3, 2008 at 12: 55 pm

    how do you get into the tree house plz post it

  • 214. 1998v  |  August 3, 2008 at 1: 05 pm

    how do u streak hair frosty plz awnser

  • 215. 1998v  |  August 3, 2008 at 1: 06 pm

    plz
    how do u get to streak hair and does it cost coins frosty plz plz plz plz plz plz plz plz plz plz plz plz plz plz AWNSER

  • 216. happygirl189  |  August 3, 2008 at 2: 01 pm

    ok i went in to the jaguar temple and i found all of the shards exept one can you plz post pictures on how to find all of the shrards?plzzzzzzzz

  • 217. horse345  |  August 3, 2008 at 3: 36 pm

    How did u get this webbie frosty. I cant seen to get one

  • 218. thao  |  August 3, 2008 at 4: 38 pm

    HEY frosty how do you get a Floating Fish ?????

  • 219. norabb  |  August 3, 2008 at 8: 27 pm

    hey frosty do u know how u get into the treehouse at wildwood glen

  • 220. norabb  |  August 3, 2008 at 8: 30 pm

    frosty r u there like omg

  • 221. norabb  |  August 3, 2008 at 8: 37 pm

    frosty r u there omg i need your help like noe

  • 222. misspeach0113  |  August 3, 2008 at 9: 24 pm

    lol, frosty u need 2 answer questions more often

  • 223. puppyluba  |  August 3, 2008 at 10: 53 pm

    uhhh frosty can you meet me on dizzywood someday?

  • 224. Giias  |  August 4, 2008 at 2: 11 am

    I need help. How do i get out of Catacroms with a brocken mining helmet?

    Enyone who can help, help too please.

  • 225. __Sakura__  |  August 4, 2008 at 3: 23 am

    frosty umm….. do u know how to get up the tree house???if u do can u plz tell me plz

  • 226. Hannah  |  August 4, 2008 at 7: 16 am

    hey i just found out that i have to have the grappling hook to get in the tree house in willwood glen can i still get one after agent bear thing?

  • 227. ducky1005  |  August 4, 2008 at 10: 57 am

    everyone, if frosty isnt answering, y r u still askin??? she prob needs some time to herself insted of bein bombored of questions.Seriously, just give her some time, and everyone eho needs help can come to my website too, ducky1005.wordpress.com

  • 228. Ruth  |  August 4, 2008 at 11: 35 am

    k so i just made a blog today do u have any tips for blog rookies like me?

    P.S
    Please post this!

  • 229. Anna  |  August 4, 2008 at 11: 58 am

    HOW DO U TAME FISH PLZ ANSWER!!!!

  • 230. goldielox/mardigragal  |  August 4, 2008 at 3: 03 pm

    Dear Frosty,
    I believe that in one post you said that dizzywood was going to get new hairstyles. I was thinking to myself “hmmm I wonder how she knew this and who did her hair” so once I saw that you had this post I came directly to it and I am hoping you will answer my question. When will the new hairstyles come out and also where do you figure out things like new hair and such?

    Mairdgragal/goldielox

  • 231. heyhey54  |  August 4, 2008 at 9: 48 pm

    how do i get into the danger room?

    plz answer soon!!

  • 232. dizzywizzy  |  August 5, 2008 at 12: 56 am

    Hey Frosty! Wanna hang out some time? I do! You decide when.

  • 233. heyhey54  |  August 5, 2008 at 4: 46 am

    How do you get into the treehouse? please reply

    P.S how do you get the grappling hook?

  • 234. first  |  August 5, 2008 at 4: 58 am

    how do you get to the tree house

  • 235. Emina  |  August 5, 2008 at 9: 31 am

    i thought this was a question board but those are questions just uhmm ……. nevermind:P

  • 236. Comfycushion1203  |  August 5, 2008 at 10: 37 am

    Seriously, we all need to know! WHERE IS THE GRAPPLING HOOK?????

    I heard that it was in the “Danger Mine” but I’ve never heard of that before. Where is it?

    -ComfyCushion1203

  • 237. frogygirl  |  August 5, 2008 at 11: 26 am

    PLZ PLZ PLZ PLZ PLZ PLZ PLZ PLZ PLZ TELL ME HOW TO GET THE SHADES!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! thx, your big fan…frogygirl ! yah for me go me go me go me (sorry random moment) lolz bye thx

  • 238. pinksmartgirl (dizzywood user)  |  August 5, 2008 at 11: 36 am

    How do you get in to Tau Parsnip mine?

  • 239. pinksmartgirl  |  August 5, 2008 at 11: 55 am

    uhm and how do you get in the treehouse? P.S. My friends got in and they won’t tell me how.

  • 240. pinksmartgirl  |  August 5, 2008 at 12: 07 pm

    I’ve been reading your column for quite a while and I this is the millionth time I’ve read it and I decided I want to meet you in Dizzywood, on Wobbly, since you like it so much. And if you don’t answer maybe you can answer when you meet me. What’s your user, Frosty, Frosty1297? Maybe I’ll find you. I want to be friends on Dizzywood, too. If they let you. How do you make a website? And I am free everyday, if you want to meet me, just say the time. Or I’ll just find you myself.I can’t wait untill you answer!

  • 241. Ashley Tisdale  |  August 5, 2008 at 12: 39 pm

    does anyone know howm to get to the parsnip mine?

  • 242. awesomed  |  August 5, 2008 at 2: 17 pm

    how do i get inside the dangerous mine plz help

  • 243. m-moneh  |  August 5, 2008 at 3: 41 pm

    Hey frosty, Im a big and fan but Im having trouble getting the cake to the chef guys daughter. Everytime I try to give it to her she says its flat. Do you know the time limit? Oh, and in catacombs how do you get into the “dangerous” place? Thanks

  • 244. roxygal99  |  August 5, 2008 at 4: 06 pm

    are you really ashley tisdae?

  • 245. mardigragal  |  August 5, 2008 at 4: 09 pm

    y do u delete ppl wen it is there idea???:’(

  • 246. Dizzypuppy1234  |  August 5, 2008 at 4: 11 pm

    ARE YOU ACTULLY ASHLEY TISDALE??!!!! I LUV UR MUSIC AND PICTURE THAT!!!! IM LYKE UR BIGGEST FAN!!!!!!!!!!!!

  • 247. vanessa hudgens  |  August 5, 2008 at 4: 13 pm

    hey frosty what would yo say about me i would like to know the truth

  • 248. b31flavours  |  August 5, 2008 at 6: 30 pm

    dose anyone know where i can find the rope to the bird house?

  • 249. 1234hereicome  |  August 5, 2008 at 6: 58 pm

    hay cool website u rock!!! :)

  • 250. jeannenguyenle  |  August 5, 2008 at 7: 38 pm

    I want everyone to know I have a blog too. Go on jeannenguyenle.wordpress and I might have the answers for you. Thanks to everybody who comes!

  • 251. jeannenguyenle  |  August 5, 2008 at 7: 42 pm

    plzz come to my blog, i have a daily activity and sorts, i will also answer quickly,plzzzzzzzzzz

  • 252. oodlesonoodles  |  August 5, 2008 at 11: 11 pm

    frosty plz help me!!!! Can u tell me where tau parsnip mine is? plz tell

  • 253. Xiumei0103  |  August 5, 2008 at 11: 58 pm

    how do i get balloons or a rope to get in the treehouse????!?!?!!?

  • 254. gotchi  |  August 6, 2008 at 2: 58 am

    jeanenguylen wats ur site call

  • 255. Ashley Tisdale  |  August 6, 2008 at 6: 21 am

    yes! dont u belive me?

    lov ya guys

  • 256. jeannenguyenle  |  August 6, 2008 at 8: 53 am

    jeannenguyenle.wordpress

  • 257. jeannenguyenle  |  August 6, 2008 at 8: 54 am

    that’s what my website’s called

  • 258. toranora  |  August 6, 2008 at 9: 31 am

    hi frosty ive always wanted to meet u! can u meet me in prestos grove on wobbly near the portal…on friday 8′th?…lol of course my name is toranora! plzz i BEG BEG BEG TO MERCY

  • 259. samantha  |  August 6, 2008 at 2: 08 pm

    k i want to do hair and get cirritrrs and stuff meet me at prestos grove tomorow six pm sharm k by

  • 260. dreamergirl101  |  August 6, 2008 at 3: 48 pm

    hey frosty!!!! ive got a Q. Do u know anything about Canada cuz my thrity year old sister is making me learn about Canada and i dont know anything about Canada just that it has a flag thats red and white with a maple leaf

  • 261. dreamergirl101  |  August 6, 2008 at 3: 51 pm

    what?! r u really Ashley Tisdale!?!?

  • 262. dreamergirl101  |  August 6, 2008 at 3: 51 pm

    omg

  • 263. cutey99  |  August 6, 2008 at 6: 51 pm

    is there a cheat code i can use if i want money

  • 264. Queen club  |  August 6, 2008 at 9: 21 pm

    plz can i be your assistent i love your website and iv seen you on dizzywood i was to nervous to ask to be your friend anyways plz write bac

  • 265. Comfycushion1203  |  August 6, 2008 at 10: 07 pm

    1. yur not Ashely Tisdale
    2. Ok, HOW DO YOU GET TO TAU PARSNIP MINE????
    3. Seriously, stop posting to Frosty! She is on VACATION! leave her alone! post to her workers or somethin!!!
    4. PRETTY PRETTY PRETTY PLEASE use my friend code!

    It is:

    Paper310

    Paper310

    Paper310

    Paper 310
    !!!!!!!!!!!!!!

    USE IT!!! PLEASE!

  • 266. bubblegumtwiller  |  August 7, 2008 at 2: 35 am

    omg u pplz have ALOT I MEAN ALOT to ask lololol

  • 267. zoozoo3  |  August 7, 2008 at 3: 06 am

    what server do you go

  • 268. Hannah  |  August 7, 2008 at 9: 23 am

    frosty where is the rope???

  • 269. Chibore  |  August 7, 2008 at 11: 54 am

    Hey frosty you had a post about where the double headed snake was but now I cant find it (I think its deleted) . All I remember is that you had to use ghostray but I forgot what you used it on… I think you should make a post telling where you can find all the animals. I only need a few, I still cant get the flutterbird though I saw it the fisrt time I went in catacombs but I thought it was a spider so I didnt get it XP Please make a post telling where they are and how to get them, thanxs!

    -Chibore

  • 270. Frosty lover  |  August 7, 2008 at 12: 13 pm

    how do you get into dizzy wood tv studio?

  • 271. pi26  |  August 7, 2008 at 2: 54 pm

    how do you do the title tingy-thing-thing or should i say the blingee bling bling hahahaha jk lol

    but how do u do the title thing?????????????

    ps: the coment has a lot of rhymes

  • 272. pi26  |  August 7, 2008 at 2: 56 pm

    :)

  • 273. :?  |  August 7, 2008 at 3: 05 pm

    there is a new activity it talks about the dizzywood olympics and how im supposed to find this torch or something and light it up. SO WHERES THE TORCH?plz help!

  • 274. kiki  |  August 7, 2008 at 9: 05 pm

    How do you levatate?

  • 275. Blah2u2  |  August 7, 2008 at 9: 24 pm

    frosty how do u get to the tree house iv”e been trying everything i cant get to it. i know ur able to because this one person dessipred and on the chats it said that they went to the tree house. i just want to know because i want to go there plese help me!

  • 276. Jessicca Linmons  |  August 7, 2008 at 9: 59 pm

    Frosty, I think you know as well as I that nobody wants to see you leave. So why are you thinking of abandoning the site? It’s like the most populor Dizzywood Cheats site, and everyone knows that! Please stay Frosty! You know how much we want you to stay!!!

  • 277. Kiol  |  August 7, 2008 at 10: 25 pm

    Where is the double headed snake

  • 278. Kiol  |  August 7, 2008 at 10: 25 pm

    p.s. u rock frosty

  • 279. Chattabox  |  August 7, 2008 at 11: 45 pm

    Frosty, I dont know if it’s to late but ignore all the mean people and just keep on going with the Website plz

    ps: Ur cheats have got me so far so plz keep updating the website and FORGET the n00bs and have a GOOOOOOOOOOOOOOOOOOOOOOODDDDDD DAY!!!

  • 280. extrawise00  |  August 8, 2008 at 12: 09 am

    how do you get all kinds of hats

    ~extra

  • 281. GreenTea  |  August 8, 2008 at 1: 03 am

    Im posting this everywher so you read it:)

    Frosty thats a silly reason to leave. Only the rude people comment because they’re jealous and won’t admit it. There are people who use your site daily they just don’t comment. The people who appreciate you outnumber the jerks in a sinche. So your telling me that the few jealous mean people are driving you to leave? why do you let them get in your head like that? By quitting your just giving them what they want. Look at all of your positive comments and all of the people who want to be your friend on the friends link. dont give up! This happens t all the succesful ones!

  • 282. Mizcool123  |  August 8, 2008 at 1: 13 am

    this is ask frosty so here it is why are you quitting

    2. why do you let the snobs get you down

    3. will you actually quit (i hope not)

    4.Not really a question but PLEASE DONT :*(

  • 283. MissChattabox  |  August 8, 2008 at 4: 41 am

    greentea, it NOT a silly reason to leave!! how would u like if u had a blog and peps were saying is dumb,stupid,un usefull N saying the blog sucks?? Ha, u dont know how it feels

  • 284. Anonymous  |  August 8, 2008 at 10: 59 am

    hi frosty how do you get into the jaguar temple i need a pet

  • 285. : \  |  August 8, 2008 at 1: 26 pm

    ok well frosty ppl clearly dont want u to leave and hopefully u wont bc ur site is incredibly helpful !! those ppl saying this blog sucks or w/e have no lives and nothing better to do then post useless comments. its pretty obvious you’ve answered A LOT of questions. the ones u didnt answer were probably repeats or easy enough to find throughout ur website. so ppl stop complaining!!!

  • 286. coolgirl600  |  August 8, 2008 at 1: 26 pm

    heres how you get in jaguar temple go to the jungle go walk into the ruin next to the river and then you will have levittaition and then go to the cam use your levitation in front of the jaguar temple

  • 287. coolgirl600  |  August 8, 2008 at 1: 28 pm

    yeah frosty you rock and i haven’t even got a cheat yet for dizzy wood so frosty don’t quit we love you so plaease don’t quit:(

  • 288. coolgirl600  |  August 8, 2008 at 1: 30 pm

    and frosty i go to this site all the time and get dizzy woood cheats and i will even make pepole on dizzy wood idmit that you rock so please don’t quit:(

  • 289. coolgirl600  |  August 8, 2008 at 1: 32 pm

    and frosty i’ll try so hard to report the stupid big meanys and then make them feel so sorry for bein mean to you so frost please stay:(

  • 290. coolgirl600  |  August 8, 2008 at 1: 33 pm

    frosty are you realy gonna quit?(please don’t quit)

  • 291. coolgirl600  |  August 8, 2008 at 1: 34 pm

    and you help us with our dizzy wood cheats and here’s a quistion um where is the magic box?

  • 292. coolgirl600  |  August 8, 2008 at 1: 35 pm

    and i need you to help me get more coins

  • 293. coolgirl600  |  August 8, 2008 at 1: 36 pm

    and don’t quit please pretty please don’t quit :( !

  • 294. coolgirl600  |  August 8, 2008 at 1: 37 pm

    it’s okay if you quit frosty i can take your place

  • 295. coolgirl600  |  August 8, 2008 at 2: 02 pm

    and frosty um how do i get i plumpox lab and the tau parsnip and the danger room?

  • 296. coolgirl600  |  August 8, 2008 at 2: 05 pm

    please tell me

  • 297. gaby  |  August 8, 2008 at 3: 21 pm

    are u really leaving frosty (DONT)

  • 298. kiki  |  August 8, 2008 at 5: 41 pm

    where is the crystal comb thingy?

  • 299. Comfycushion1203  |  August 8, 2008 at 7: 26 pm

    I do NOT want u to leave! I realize maybe I was one of those jerks, maybe, cause I was a bit mean and told this girl that she WAS NOT Ashley Tisdale… but really, please. I almost made my own site, so that I could be like all the cool people on this sight, like u, Booh, Waddles, coolieperson, Jigsaw, etc. and well, just please. please. I have never been into a site like this and dizzywood! So I wanna be like u guys! I want someone to SPEAK directly to me! like: Hey ComfyCushion! how are you? Or, ComfyCushion, the answer to yur question is… just something like that! look, I’m only 10 years old, So yeah, I’m “a little kid”. Not even in Middle School! OUCH! sorry, I just got a paper cut… anyway, So nobody will even CONSIDER answering this. But Frosty, You probably have had a BILLION messages saying, “Don’t Go Frosty! U rock! We’re gonna miss u so much!!!” I hope this doesn’t seem like one of those. Thx

    -ComfyCushion1203
    :-(
    :-)

    Hope u read this!

  • 300. xannybee  |  August 9, 2008 at 4: 41 am

    hey frosty what is the last thing you have to do in the dizzywood olympics and how do you get to the TREE HOUSE

  • 301. dad2  |  August 9, 2008 at 6: 23 am

    how did you get your own chat?

  • 302. dad2  |  August 9, 2008 at 6: 24 am

    how do you gwt to the tree house ?? I realy want to know

  • 303. anon  |  August 9, 2008 at 8: 52 am

    how do i get down in skytown after i float because i cant fall in the catacombs or werever i go

  • 304. Queen club  |  August 9, 2008 at 9: 35 am

    y do you want here go why she helped us get more experience in dizzywood she helped us lagh and have fun in dizzy wood so i say she should stay plz guys help here stay in dizzy wood help her live the life on the computer!!!

  • 305. Queen club  |  August 9, 2008 at 9: 40 am

    plz vote frosty to stay
    she never did anything to hurt us and you guys say you want here to leave you jerks are the worst some ppl need here yaknow and you guys dont even care about the other ppl you are courds jerk and retards yaknow that you guys should be hobos your very selfish and only think of yourself ok bye

  • 306. audaud123  |  August 9, 2008 at 10: 25 am

    are u still checking ur blog? and how do u get to the treehouse?

  • 307. audaud123  |  August 9, 2008 at 10: 29 am

    what’s ur dizzywood username?

  • 308. friend  |  August 9, 2008 at 2: 06 pm

    how do u get in the tree house?

  • 309. friend  |  August 9, 2008 at 2: 07 pm

    and dont quit

  • 310. Horse  |  August 9, 2008 at 2: 49 pm

    Dear Frosty,
    What is the Dizzy Tv station/ HOW do I get there ?

  • 311. Emina  |  August 9, 2008 at 4: 04 pm

    zapp a tv whoops i wasn’t supposed to answer that srry

  • 312. Emina  |  August 9, 2008 at 4: 06 pm

    omg this is american! I didn’t know that! oh well at least I know when to go on now.

  • 313. coolgirl600  |  August 9, 2008 at 5: 13 pm

    frosty don’t quit and where the heck is the magic box ,love coolgilr600

  • 314. coolgirl600  |  August 9, 2008 at 5: 13 pm

    i mean coolgirl600

  • 315. icon10  |  August 9, 2008 at 7: 47 pm

    where is the rope pls………………….. tell me??????????

  • 316. gogirlstar  |  August 9, 2008 at 7: 55 pm

    Why are u leaving (sorry i just want an answer cause i hate it when people leave without telling me why) :cry:

  • 317. Cupcake5814  |  August 9, 2008 at 9: 12 pm

    where is the rope or thing to get to the treehouse? plz tell me plz plz plz but i know its somewhere in dizzywood cuz someone went to the treehouse (i saw them with my two eyes) so if you find out plz plz tell me

    Love,
    Cupcake5814 =p

  • 318. Lizzie  |  August 9, 2008 at 9: 40 pm

    Hi, Frosty. This is probably a weird question to ask but, do you know if you need something to get the fishing rod? I clicked on it but nothing popped up. Please answer if you can. BTW, what server are you usually on? I’m Miley0979 :lol:

  • 319. Blahblitty  |  August 10, 2008 at 2: 56 am

    Frosty can you tell me how to make your site so popular because my site reeks i have like no viewers

  • 320. RetroFunGirl :D  |  August 10, 2008 at 4: 08 am

    Are you going to quit? [plz be a no] lol

  • 321. DarkOricle  |  August 10, 2008 at 4: 24 am

    Frosty pls answer my question!

    Who do i besum 1 pf ur workers
    coz im a dwood 24/7

    PLS ANSWER

    tnx
    love DarkOricle:)

  • 322. DarkOricle  |  August 10, 2008 at 4: 25 am

    I MEAN HOW DO I BECUM 1 OF UR WORKERS

  • 323. coolgirl  |  August 10, 2008 at 1: 04 pm

    frosty look, the people who say you are a jerk and taht you are bad is not true. They are jerks, dont believe them, ignore them. I have a website and people said i am a jerk and stuff like that, but i ignored them, but not a lot of people come anywhere.

    me and my friends, just like to have fun on the website.

    so its really up to you, if you wanna quit!!!

  • 324. Yoshi66  |  August 10, 2008 at 1: 15 pm

    Hi. I know stardazzle and she told me u knew where the peice i in the mineshaft can u plzzz show me sometime or tell me????

  • 325. Yoshi66  |  August 10, 2008 at 1: 23 pm

    I know that the rope os not in tangle vine jungle, prestos prestos edge, and the treasure room.

  • 326. divaofpanic20  |  August 10, 2008 at 2: 23 pm

    Hi frosty! I’m a pathfinder. Are you? And, will you meet me in dizzywood?

  • 327. penguins rule 33  |  August 10, 2008 at 4: 48 pm

    y am i a cat?

  • 328. friend  |  August 10, 2008 at 6: 22 pm

    will u meet me in dizzywood i really wwant to meet u!!!!

  • 329. friend  |  August 10, 2008 at 6: 22 pm

    and why do i look licke null!!!!!

  • 330. friend  |  August 10, 2008 at 6: 23 pm

    and a cat

  • 331. friend  |  August 10, 2008 at 6: 23 pm

    p.s. are u a pathfinder??????:D

  • 332. icon10  |  August 10, 2008 at 7: 18 pm

    pls……………………………………….help me where is the rope??????????????????????????????pls……………….tell me

  • 333. HELP ME!! my real dizzywood name is yankee443  |  August 10, 2008 at 8: 00 pm

    Frosty ok i really need your help on this one
    1. do u know where the rope is for the tree house
    2. where is it if u know
    3. where is twilight pines
    4. how do u get to rau parsnip
    5. HELP ME PLZ!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

  • 334. Horse  |  August 10, 2008 at 8: 22 pm

    where is the tv i zap to get to dizzy tv studio

  • 335. zoodog895  |  August 10, 2008 at 9: 43 pm

    Hey frosty i was just wondering how you get the rope
    i opened the magic box but it didnt give me it!
    :(

  • 336. uurika  |  August 11, 2008 at 2: 41 am

    frosty,
    i hope you can answer this and say yes
    can i work here for you

  • 337. uurika  |  August 11, 2008 at 2: 42 am

    frosty,
    where’s the magic box

  • 338. JazzGal  |  August 11, 2008 at 3: 00 am

    frosty i i i dont want you to leave it dosnt matter what those jerks say at least u got al of us ((not those snobs )) the people who are nice so plz plz plz plz plz dontleave i wouldnthave gotten here with out ur help frost plz stay

  • 339. baba2000  |  August 11, 2008 at 4: 25 am

    how do you get zap powers?
    la la la and do you have them?

  • 340. gigglyyyy  |  August 11, 2008 at 5: 15 am

    you should leave!
    your site is a bit wierd and other peopkle cant make a site coz if they would it would be like yours (if they make a dizzywood site).

    leave leave leave!

    coz its so not fair! you have other helpers who will do the job!

  • 341. fgwrfgxc  |  August 11, 2008 at 5: 17 am

    even your helpers dont want you!

    why else would they change a lovely headler do some rubbish

  • 342. diffjy  |  August 11, 2008 at 5: 19 am

    quit!

  • 343. ilv123  |  August 11, 2008 at 5: 20 am

    hi frosty!

    dont quit! you are the best of all your helpers!

  • 344. rika510  |  August 11, 2008 at 9: 06 am

    Please I am your #1 fan trust me!!! PLEASE PLEASE PLEASE PLEASE PLEASE PLEASE PLEASE PLEASE PLEASE PLEASE PLEASE DON’T QUIT I WILL MISS U!!! WE WILL ALL MISS YOU!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

  • 345. rule_cnc34  |  August 11, 2008 at 10: 51 am

    frosty why are you leaving!?\

  • 346. schutzgirl56  |  August 11, 2008 at 12: 45 pm

    Frosters do u know how to get into the treehouse?… WHY ARE U LEAVING????????!?!?!!!!!?!?!?!?!?!?!!?!?!! :( :( :( :( :( :( :( :(

  • 347. MIZCOOL123  |  August 11, 2008 at 5: 21 pm

    Y U SUCH AN A HOLE NAT!????

  • 348. alex(:X3:)  |  August 11, 2008 at 7: 49 pm

    ok so how do u get
    levitation power

  • 349. Music2468  |  August 11, 2008 at 8: 50 pm

    ummmm… hummm…. o yea, how d u get the stuff for ur site??? i hav my own site so i wanna know(its NOT bout DW so im NOT coping u and i started my site b 4 i saw urs(i saw ur site today when someone told me to type Dizzywood cheats on google))
    btw ill b on Twirly all day today so i wanna meet u there im gonna b in grove rite now. im jogging around for the dizzywood olympic games so ll b sorta b hard to find. but a challenge is good rite?
    sorry for typing so long but u gotta see this soo. anyway ill b usaully on Zany so if u read this 2morow go on Zany so yea
    i end my comment/question

  • 350. Music2468  |  August 11, 2008 at 8: 51 pm

    any one no how go in tree house? (no ones answering me in the Dizzywood Explorer Journal (the real thing not the one on this site))

  • 351. Music2468  |  August 11, 2008 at 8: 52 pm

    anyone hav a Jangleberry plant or a Joysnap plant??? ill be on Zany if u do! i mite b in garden (hint,hint)

  • 352. Music2468  |  August 11, 2008 at 8: 52 pm

    k im actually on Twirly

  • 353. angelgirlgirl  |  August 11, 2008 at 10: 32 pm

    how do you put photos on to your blog?

  • 354. JazzGal  |  August 12, 2008 at 2: 31 am

    its not fair fosty if u look at this mail i hate you u left me and all of us who trusted u i hate hate jhate you

  • 355. Emina  |  August 12, 2008 at 4: 10 am

    so if frosty is leaving why call it frosty dizzywood cheats?

  • 356. daisy4231  |  August 12, 2008 at 1: 35 pm

    how do i get a pet, frosty?

  • 357. daisy4231  |  August 12, 2008 at 1: 36 pm

    just wondering

  • 358. braidyrae2012  |  August 12, 2008 at 1: 36 pm

    WERE IS THE ROPE FOR THE TREEHOUSE! IT IS DRIVING ME MAD!!

  • 359. yankee443  |  August 12, 2008 at 3: 34 pm

    frosty how do girls get hats in dizzy wood like the boys im confused how???????????? like the sideways hat how

  • 360. eRICA  |  August 12, 2008 at 4: 36 pm

    Where is the rope or grapling hook for the treehouse? I REALLY WANT TO KNOW!! also… how can i get into the “Danger Room” ? PLEASE REPLY!!!

  • 361. eRICA  |  August 12, 2008 at 5: 06 pm

    where is the rope to the treehouse I REALLY WANT TO KNOW!!! please reply back. I LOVE UR BLOG…… DOOOONNNNTTT GGGGGGOOOOOO!!!

  • 362. pinkkea  |  August 12, 2008 at 5: 11 pm

    DONT GOOO!!!

  • 363. surry  |  August 12, 2008 at 8: 00 pm

    where is the key to the tree house

  • 364. surry  |  August 12, 2008 at 8: 01 pm

    the rope is at tanglevind jungle

  • 365. dylan  |  August 12, 2008 at 9: 40 pm

    whats the levition cheat on moshi monsters?

  • 366. GreenTea  |  August 13, 2008 at 12: 30 am

    Ugh come on frosty pick yourself up and brush your shoulders. Dont let haters rule your life. I’m not telling you not to quit your right: its your life. but be strong. dont give up like eveyone else. you are the only site with consistent cheats.

  • 367. smiley  |  August 13, 2008 at 4: 47 am

    frosty plzzzzzzzzzzzzzzzzzzz tell me how to get to the tree house i have been looking for ages. and plz don’t quit.

  • 368. whyyou leaving?  |  August 13, 2008 at 5: 32 am

    DEAR FROSTY IM GONNA LEAVE LOTS OF SPAM MAIL ON THIS OLD SITE SAYING WHY ARE YOU LEAVING :( :( :( :( :( :(

  • 369. whyyou leaving?  |  August 13, 2008 at 5: 33 am

    DONT QUIT PLZ PLZ PLZ COME BACK

  • 370. whyyou leaving?  |  August 13, 2008 at 5: 33 am

    DONT LEAVE :( :( :( no one is happy

  • 371. whyyou leaving?  |  August 13, 2008 at 5: 34 am

    NO DONT LEAVE COME BACK

  • 372. whyyou leaving?  |  August 13, 2008 at 5: 35 am

    NOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO

  • 373. X_BlueNote_X  |  August 13, 2008 at 9: 41 am

    NOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
    Dont go frosty

  • 374. uuuuuuuuuuu  |  August 13, 2008 at 1: 07 pm

    hey guys! i know where the rope is!just step on the air grate in jungle and u’ll find it in a tree

  • 375. coolpup101  |  August 13, 2008 at 2: 23 pm

    ok so i saw you in prestos grove but u were not on wobbly and are u my budy or was it just a weird erson trying to be idk but wait they cant have the same user name well what ever umm can u check if i am your buddy and please dont delete me if i am thanks

  • 376. jeannenguyenle  |  August 13, 2008 at 9: 08 pm

    umm, hi ducky!

  • 377. GreenTea  |  August 13, 2008 at 9: 11 pm

    K fine frosty be a big baby

  • 378. Jessica  |  August 13, 2008 at 9: 50 pm

    How do you get to crystal catacombs. I can’t figure it out! Please help me. I’m new and am still learning things.

  • 379. GreenTea  |  August 14, 2008 at 1: 24 am

    You go through the jaguar temple which is in the explorers camp. You need invisibility to get there then you fall and you’re in the crystal catacombs. Now that frosty was a big baby and gave up someone needs to help. thanks again frosty. good going =/

  • 380. Cameron  |  August 14, 2008 at 4: 34 pm

    hey how do you look at your friend code

  • 381. tyoxo  |  August 14, 2008 at 4: 48 pm

    yay frosty’s go’n

  • 382. tyoxo  |  August 14, 2008 at 4: 49 pm

    frosty’s go’n yay

  • 383. coolgirl600  |  August 14, 2008 at 11: 51 pm

    meany tyoxo i don’t mean to be mean and harsh but i don’t like that commet

  • 384. coolgirl600  |  August 14, 2008 at 11: 51 pm

    and hey frosty how do i get in rat wraith and other places that say keep out besides the mines?

  • 385. angelmn  |  August 15, 2008 at 12: 48 am

    frosty whats the ansers for pathfinder beacse on the therd
    qeshen it keep saying rong anser its frustrating!! plz help me:[

  • 386. JazzGal  |  August 15, 2008 at 1: 37 am

    god why trust frosty anyway shes gone and i hope she dosnt come back. shes a back stabber and i trusted her but ive made up my mind. I HATE HER

  • 387. greatartgirl10  |  August 15, 2008 at 6: 25 am

    Frosty’s gone guys. No point in asking questions anymore.

  • 388. frosty  |  August 15, 2008 at 10: 17 am

    what the heck is with you guys! im a backstabber,a jerk, and that i an idiot that cant be trusted, because i QUIT? thats not fair because i never did anything t you! if i quit thats my choice because i have a LIFE. all of you are being selfish and mean, not the people who always sucked up to me when i was ere. and that means your a jerk and a liar. so if all of u are gonna be like this , because i HAVE seen your comments, then im glad i quit because i would never ant to help you brats anymore, because you dont deserve to be helped!

  • 389. Cameron  |  August 15, 2008 at 4: 21 pm

    plz frosty im sorry that your being called all that stuff so plz dont leave.

  • 390. MKMdoggie  |  August 15, 2008 at 5: 54 pm

    Frosty can it meet you in Dizzywood? PLZ PLZ PLZ!

  • 391. MKMdoggie  |  August 15, 2008 at 6: 00 pm

    Frosty I never said anything mean to you, and why did you say all
    that stuff! THIS THE WORST THING ILL SAY TO YOU AND THE LAST! I’M GLAD YOUR QUITING!

    P.S. IM NEVER COMING BACK!

  • 392. frosty  |  August 15, 2008 at 7: 32 pm

    see there everyone goes again! point proven, its not like im talking directly to everybody..just some ppl. god

  • 393. sappfire  |  August 15, 2008 at 8: 40 pm

    I know how to get into the tree house!You just have to go to
    Tanglevine Jungle and you go on the air grate then theres a rope
    and a hook then you click on it and then you can go to the
    house!I got these cool sunglasses for 1000 bucks!

  • 394. breeanagirlcat  |  August 16, 2008 at 1: 03 am

    Frosty they dont mean it we want you to stay!!!!!! They just said it to make you quit,to make you mad,to make you leave. Whoever said mean stuff about FROSTY your an idiot,a jerk, a backstabbing liar!!!! i meant it Frosty is nice!!! she is our life we all are her fans!!!!!!!!! please dont leave!

  • 395. 1995c  |  August 16, 2008 at 2: 16 pm

    i dont want her 2 leave either but its her choice let her leave…and frosty is ur life..?…..thats kinda pathetic

  • 396. abdul  |  August 17, 2008 at 11: 36 am

    hi frosty
    i made a new account coz the other one is bloked and need to kno how to get zap
    on the bloked one i had it
    but now its really different
    plzzzz tell me how to get it

    thanx :)
    from dyamite777 the bloked one is dynamite777

  • 397. abdul  |  August 17, 2008 at 11: 41 am

    y r people bein rude to frosty
    thats stupid
    let her leave
    its her life lol
    people hu dont want her to leave coz they will miss her kk
    but people bein mean thats coz they dont have a life
    its ur choice frosty and if u do leave laterz

    thanx

  • 398. Lillyavatar767  |  August 17, 2008 at 3: 37 pm

    MKMdoggie im glad your never coming back its people like you who made frosty want to quit.

  • 399. gonalago  |  August 17, 2008 at 6: 42 pm

    how do you get the flutterbird

  • 400. shoot  |  August 17, 2008 at 7: 53 pm

    DONT LEAVE FROSTY DONT LEAVE!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! CIES

  • 401. yankee443  |  August 17, 2008 at 7: 54 pm

    CRIES LOUD DONT LEAVE FROTY DONT LEAVE!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

  • 402. coolgirl600  |  August 17, 2008 at 7: 59 pm

    frosty who the heck is null and how old are you i am 6 yrs old

  • 403. DW Gal Pal  |  August 17, 2008 at 9: 09 pm

    Do you have to pay to have your own word press?

  • 404. Pokedreams  |  August 18, 2008 at 11: 43 am

    Were do you learn Zap

  • 405. Dizzywoods  |  August 18, 2008 at 11: 53 am

    Were do you get zap

  • 406. spacecat  |  August 18, 2008 at 1: 33 pm

    pleeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaas dont quit plzplzplzplzplzplzplzplzplz

  • 407. spacecat  |  August 18, 2008 at 1: 34 pm

    pleeeeeeeeeeeeeeeeeeeeeeaaaaaaaaaaaaz
    dont quitplz plz plz plz plz plz plz plz plz plz plz

  • 408. spacecat  |  August 18, 2008 at 1: 36 pm

    i wil miss you so mutch if you dont whant her to quit send messages like me about it

  • 409. spacecat  |  August 18, 2008 at 1: 38 pm

    send me back if you dont wanna quit

  • 410. spacecat  |  August 18, 2008 at 1: 44 pm

    who said that stuff and dont quit we realy dont whant you to plz we all love you
    plz stay you the greatest person ever

  • 411. spacecat  |  August 18, 2008 at 3: 43 pm

    shese back

  • 412. Kristin  |  August 18, 2008 at 4: 37 pm

    its more of a question, and here it is:

    how do i get wallpaper for my house?

    ive asked ppl but they never tell me, will u?

  • 413. SPORTY1418  |  August 18, 2008 at 6: 49 pm

    frosty so left so no more commenting well u can but she wont reply

  • 414. SPORTY1418  |  August 18, 2008 at 6: 51 pm

    and in one of the showrooms go to the walls and there is frames u can click them their wall papers and flooring

  • 415. Chubchub829  |  August 19, 2008 at 7: 08 pm

    what are the answers to the dizzywood pathfinders quiz?

  • 416. noof  |  August 21, 2008 at 7: 37 pm

    hey srosty why do you dont play on dizzywood

  • 417. Anna  |  August 22, 2008 at 12: 46 pm

    Hi! do you know how you can color peoples hair

    Thanks1

  • 418. Trixy3  |  August 23, 2008 at 9: 06 am

    when you go to jaguar temple interloper is blocking the entrance so how do you get past?

  • 419. juddyduddy123  |  August 23, 2008 at 2: 50 pm

    hiw do you get the emotes from plz help me plz!!!!!!!!!!!!

  • 420. juddyduddy123  |  August 23, 2008 at 2: 51 pm

    i mean how

  • 421. juddyduddy123  |  August 23, 2008 at 2: 52 pm

    i mean how do you get the emotes

  • 422. bookworm  |  August 23, 2008 at 9: 27 pm

    hi umm how do u beat the game blocks and get into the onakasi treasure room ???

  • 423. jeannenguyenle  |  August 25, 2008 at 8: 57 pm

    i miss frosty

  • 424. ruthrose8  |  August 27, 2008 at 4: 25 pm

    how do u telaport ive only been on edge grove and jungle

  • 425. sappfire  |  August 27, 2008 at 5: 59 pm

    does anyone know where the first honeycomb is?

  • 426. noof  |  August 28, 2008 at 5: 13 pm

    i know

  • 427. GreenTea  |  August 29, 2008 at 1: 28 am

    You sort of lose respect for a person when they give up under pressure like that. what a joke

  • 428. spacecat  |  August 29, 2008 at 5: 01 pm

    sappfire remember me space cat i am your buddy

  • 429. xxcastawayxx  |  August 30, 2008 at 9: 15 pm

    my question is….why do u have to go?

  • 430. nitprin  |  August 30, 2008 at 9: 53 pm

    y did u leave nooooooooooooooo i dident even meet u yet. i know its ur life u do whut u wont but every one is gonna miss u ive been trying to buy alot of expencive stuph for my room so if i ever see you i could actualy empress u. cry cry cry. y did u half to go. dont get mad at this message its just letting u no how i feel u shouldent have gone. but its ur lif so umm well if this message affended u in any way im sorry i i just dont wont u to go. but cince u did we will miss u. ill throw a big goin away party for u and no one will forget u. so BYE frostie :] have fun.

  • 431. willow  |  August 30, 2008 at 10: 04 pm

    jk its not willow its me nitprin lol

  • 432. willow  |  August 30, 2008 at 10: 05 pm

    i shal be discuiesed as willow from now on lol jk

  • 433. scooter  |  August 30, 2008 at 10: 06 pm

    still again y did u half to go ps its nitprin

  • 434. scooter  |  August 30, 2008 at 10: 07 pm

    y did u leave nooooooooooooooo i dident even meet u yet. i know its ur life u do whut u wont but every one is gonna miss u ive been trying to buy alot of expencive stuph for my room so if i ever see you i could actualy empress u. cry cry cry. y did u half to go. dont get mad at this message its just letting u no how i feel u shouldent have gone. but its ur lif so umm well if this message affended u in any way im sorry i i just dont wont u to go. but cince u did we will miss u. ill throw a big goin away party for u and no one will forget u. so BYE frostie :] have fun.

  • 435. scooter  |  August 30, 2008 at 10: 07 pm

    y did u leave nooooooooooooooo i dident even meet u yet. i know its ur life u do whut u wont but every one is gonna miss u ive been trying to buy alot of expencive stuph for my room so if i ever see you i could actualy empress u. cry cry cry. y did u half to go. dont get mad at this message its just letting u no how i feel u shouldent have gone. but its ur lif so umm well if this message affended u in any way im sorry i i just dont wont u to go. but cince u did we will miss u. ill throw a big goin away party for u and no one will forget u. so BYE frostie :] have fun!

  • 436. nitprin  |  August 30, 2008 at 10: 08 pm

    y did u leave nooooooooooooooo i dident even meet u yet. i know its ur life u do whut u wont but every one is gonna miss u ive been trying to buy alot of expencive stuph for my room so if i ever see you i could actualy empress u. cry cry cry. y did u half to go. dont get mad at this message its just letting u no how i feel u shouldent have gone. but its ur lif so umm well if this message affended u in any way im sorry i i just dont wont u to go. but cince u did we will miss u. ill throw a big goin away party for u and no one will forget u. so BYE frostie :] have fun!!

  • 437. nitprin  |  August 30, 2008 at 10: 09 pm

    y did u leave nooooooooooooooo i dident even meet u yet. i know its ur life u do whut u wont but every one is gonna miss u ive been trying to buy alot of expencive stuph for my room so if i ever see you i could actualy empress u. cry cry cry. y did u half to go. dont get mad at this message its just letting u no how i feel u shouldent have gone. but its ur lif so umm well if this message affended u in any way im sorry i i just dont wont u to go. but cince u did we will miss u. ill throw a big goin away party for u and no one will forget u. so BYE frostie :] have fun!!!

  • 438. Blu_e01  |  September 1, 2008 at 2: 56 am

    can u come back?

  • 439. xlozxno1x  |  September 1, 2008 at 12: 29 pm

    What do you have to do to ge into the places behind the keep out signs?? plz reply xxx

  • 440. cellie555627  |  September 1, 2008 at 3: 14 pm

    Can i meet u on dizzywood please???????? plz plz plz?????????

  • 441. champdj  |  September 4, 2008 at 10: 41 pm

    how do you stop the machine in the tunnels?

  • 442. katie  |  September 6, 2008 at 4: 12 pm

    hey when i go on dizzywood in the night like 9 o clock it dont come on it sais my account is disabled why is that????

  • 443. Natalie  |  September 7, 2008 at 4: 18 am

    Hi frosty when can i meet you on dizzywood and are you still alive sorry to say that.

  • 444. Cathy  |  September 8, 2008 at 7: 09 pm

    Hey Frosty,
    I saw u on dizzywood i am Moroca03 u kept running away from me why did u run away from me at the beach so i really want to be on your friends list if u are looking for me i will be on the server Zany i really know a lot about dizzywood plz plz

  • 445. lhalligan  |  September 9, 2008 at 2: 58 pm

    r u teen or a kid or a pre teen?

  • 446. callie  |  September 10, 2008 at 5: 38 pm

    how do u buy a pet on dizzywood

  • 447. Alexa Lewis  |  September 15, 2008 at 9: 03 pm

    hey do you know a girl named bigrocker11

  • 448. ranielle_0805  |  September 16, 2008 at 3: 15 am

    hi frosty!!

  • 449. isi101  |  September 19, 2008 at 3: 28 am

    i am really annoyed about getting disconnected all the time can u tell we why you get disconnected? PLZ

  • 450. Sassy  |  September 20, 2008 at 6: 30 pm

    Can u tell me where to find the eyes to the jagua cave it would be awesome if you could alsotell me where all the pices of the statue in garden gazebo are to thanx

  • 451. Sassy  |  September 20, 2008 at 6: 31 pm

    Also your site is totally awesome

  • 452. Sassy  |  September 20, 2008 at 6: 32 pm

    can you plz answer my questions asap

  • 453. coolgirl600  |  September 21, 2008 at 3: 11 pm

    dear,frosty how do you get in tau parsnip?

  • 454. nitprin  |  September 21, 2008 at 5: 29 pm

    did u leave nooooooooooooooo i dident even meet u yet. i know its ur life u do whut u wont but every one is gonna miss u ive been trying to buy alot of expencive stuph for my room so if i ever see you i could actualy empress u. cry cry cry. y did u half to go. dont get mad at this message its just letting u no how i feel u shouldent have gone. but its ur lif so umm well if this message affended u in any way im sorry i i just dont wont u to go. but cince u did we will miss u. ill throw a big goin away party for u and no one will forget u. so BYE frostie :] have fun.

  • 455. browney  |  September 25, 2008 at 6: 37 am

    how do you get lots of money

  • 456. browney  |  September 25, 2008 at 6: 40 am

    gfvavfvfgvfwejfjfejfgsfjfgsjfgasjfgjfgkjgfsekjgfjsksfsajgfsgfsfgsjfsjhfsfasfsekjfsjfghvhbbcvcavcasbbxbxzvbbvmcxzbxvzzxvbsdfgasdfhgkfwyegfsgkmnbvcxzlkjhgfdsapoiuytrewqsbfjfgsefkgrafgvruovfouewvfouwfgvoeuvfoeurgfuavfuowevfaouvyfgafgaewifgweiyfgioHGFWHGFWEVFWuovfweoufgvweufufwfghaijhjkfgjiggijgibogigtijnnjifjinfvijnvffinoibbribuirbg4gt95498498986596598096508809tiueigdvbhjvbhfbibrui93474436893476765564267846982365489gbgkfhbefbgkhbgehbreiglryetoughrireibibsibvibxzbxmnv,,mnabakjhasklhgshsdklialladlkjgsiwwqyowiugoifgdigdsdigsdjgdsjksdfhjdsgasdgshsdhgsdhgsadhfgassdgfasjfewgoiwyqvywveoyhvegwervegavgfhgfewtfwufwufwuqfgqwugweuvgqweiufuvsvcbvnnbczvvbvgvfgsddgsdagsdajfdsagshasadfhwwwtqwyteiqwietqewtpiwepitdhggshdghaghladsfhgadsflhdfhghashbnvzczcvbBMbxccbzbvnvznvnvnvjgafdsjfyurouuegvsaksgdvgfuwfeugdsvcgavctefavsdgvfeauewfutfewafuewdgvvcvzxcvbnmlkjhgfdsapoiuytrewwqmnbvcxzasdfghjklpoiuytrewq

  • 457. coolgirl600  |  September 27, 2008 at 2: 04 pm

    dear frosty, don’t leave if i see you on dizzy wood i will drop a portal and have a goin away par-tay for you

  • 458. coolgirl600  |  September 27, 2008 at 2: 04 pm

    how do i get in tau parsnip anyone awnser

  • 459. tnf97  |  September 28, 2008 at 9: 11 am

    How do you buy pets. I really want some more but I do not know how to buy them

  • 460. comfycushion1203  |  October 2, 2008 at 9: 50 pm

    Frosty, yur horrible. I mean, what happened to u? u used 2 b so nice…u were my hero! and now, u suddenly say “I’m leaving” and u go away cause some jerks hacked into yur sites. I mean seriously! Wat happened to u? wat did u DO on that vacation? so, I think u should reopen.

  • 461. tiffany  |  October 3, 2008 at 10: 33 pm

    where are the blue crtals and how do they look like?

  • 462. tiffany  |  October 4, 2008 at 4: 44 pm

    how does a blue crytal look like you need all the blue crytals to make a bunnycorn and i want a bunny corn and you need a bunnycorn to be a pathfinder and i want to be a pathfinder please put the picture of the blue crytal if you see one in the jagar temple in the or above the platforms.

  • 463. AEROny87  |  October 5, 2008 at 1: 09 pm

    how do u get a joysnap and jangleberry??

  • 464. GirlySweet  |  October 9, 2008 at 5: 20 pm

    I need to know where the E.C.s equipment is.

  • 465. Anonymous  |  October 11, 2008 at 7: 48 pm

    well where is E.C.S eguipment plz tell

  • 466. coolgirl600  |  October 11, 2008 at 11: 40 pm

    frosty why do have to go there are so many of us who want to know about dizzywood and guys who want her to leave i’ll find ya on dizzy wood and i’ll zap ya and re-port ya and frosty i miss you and we all do frosty please come back and if you do you can maybe ask presto for trades to add to your dock and i’ll trade with you and i’ll give ya a fishy critter please do not leave if you do i’ll just never comment here signed coolgirl hugs and kisses i miss you

  • 467. Courtney  |  October 14, 2008 at 6: 01 pm

    Dear Frosty,

    How do you zap everyone is zappin me and im about to die not zapping them back!

  • 468. Maryann  |  October 15, 2008 at 5: 04 pm

    How can i tame a fish

  • 469. Sara  |  October 17, 2008 at 12: 05 am

    I am your biggest Fan, any chance of meeting u or at least you answering?

  • 470. amy  |  October 18, 2008 at 8: 28 pm

    whats the best way to have sex with a male

  • 471. hannah  |  October 18, 2008 at 11: 36 pm

    what are the answers to the test

  • 472. Sascha  |  October 20, 2008 at 4: 47 am

    How do you make a blog tell me! tell me!

  • 473. wonderwordpress  |  October 22, 2008 at 9: 14 pm

    wazzup frosty?
    im a numbah1 fan of urs n got questions plz answer em
    how did you make ur own chatbox?
    where did u see dora?
    where do u get these cool stuff and emotcions lik th epuppy n stuff thx ps when i put down my pets it says there nulls!
    ~another websiter on wordpress.if u wanna visit me site go to
    wonder1000.wordpress.com bye

  • 474. ReRe79  |  October 25, 2008 at 9: 07 am

    how do u get into the skull and crossbone area? I really want to know.

  • 475. drew  |  October 25, 2008 at 2: 56 pm

    where is the last of h.c’s tools?

  • 476. emma  |  October 25, 2008 at 5: 13 pm

    Help! how do i get to the tv station?!?!?!

  • 477. lol:lol:lol  |  October 29, 2008 at 10: 50 am

    hi frosty can u tell who null is plz………….
    thx :lol:
    p.s love ur website

  • 478. lol:lol:lol  |  October 29, 2008 at 10: 52 am

    hi frosty can u tell who null is plz………….
    thx :lol:
    p.s i love ur website
    and can i meet u on snazzy on 30th october at 09.00am (my time cause im in uk :) thx

  • 479. frosty  |  October 29, 2008 at 10: 54 am

    i cant remeber LOL :) but i lv u all so i gotta go and im not doin anymore websites k bye

  • 480. superstar673  |  October 29, 2008 at 7: 13 pm

    what do you do with moxie mulch

  • 481. Anonymous  |  October 31, 2008 at 5: 26 pm

    why did u make dizzywood sooooo safe???? cause sometimes its tosafe and u can not say anything. But i like it how it is and if u do get banned itz only for a little while so thats alright well yea thankz bye bye

  • 482. Anonymous  |  October 31, 2008 at 5: 33 pm

    HEY i love u!!!!!!!!! u rock my world

  • 483. blahblitty  |  November 2, 2008 at 11: 12 pm

    where are the blue crystal shafts in jaguar temple??? i can only find three!!!! i can’t find the one on the first plateau OR the one with the big opal face head on it. help!!!!!!

  • 484. sugarspice  |  November 5, 2008 at 6: 05 pm

    oh and do you like clud pun somthing more then dizzywood (cryies) answer to first thing i said first plz

  • 485. frosty  |  November 5, 2008 at 6: 13 pm

    uhm dizzywood is differnt….and i dont like it at all.so i went BACK to clubpenguin, which used to be on my site before dizzywood even existed.

  • 486. Lavykins  |  November 6, 2008 at 10: 32 am

    Hiya Frosty!
    I’m new in dizzywood so i’ll need some help adjusting.
    can u recommened some helpful advice?
    PLZ! DON’T LEAVE THIS SITE!
    AND KEEP ENTERING STUFFF ‘BOUT C.P TOO
    LUV YA!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

  • 487. pebbypearl  |  November 7, 2008 at 1: 27 pm

    wat wud u do if ur BFF on cp deleted u? that happened to me! Waaaaaaaaaaaaah!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

  • 488. pinkkea  |  November 7, 2008 at 4: 28 pm

    Frosty quit Dizzywood. Basically, that means not to go asking her questions about it anymore.

  • 489. Bloony  |  November 8, 2008 at 12: 41 am

    hi,

    At clubpenguin the dojo is bing fixed and you can get a shovel… where do you get it?

  • 490. pebbypearl  |  November 8, 2008 at 1: 40 pm

    how u doing frosty? ive just changed my nickname soooo ull see wat lol . im pebbypearl on cp but ppl call me eeyore i used to be muffin but i want muffin again sooo! ppl call me muffin plzz reply i BEG!xxx ;) :) ! u rock ^__^

  • 491. pebbypearl  |  November 8, 2008 at 1: 41 pm

    o yea as u know its MUFFIN lol

    ~muffin~!

  • 492. kandyriot  |  November 8, 2008 at 2: 13 pm

    hey frosty do u ever miss dizzywood??

  • 493. pinkkea  |  November 8, 2008 at 8: 24 pm

    Hi Frosty~
    Why’d you suddenly rejoin WordPress and then start clubpenguin again?? I mean you quit CP before and then dizzywood. Then you quit Dizzywood. Then you rejoined CP. :mrgreen: It’s WEIRD.

  • 494. frosty  |  November 8, 2008 at 8: 32 pm

    differnt things catch my attention at differnt times lol. it always helps when im bored too ;)

  • 495. kka2297  |  November 9, 2008 at 12: 55 am

    FROSTY FROSTY FROSTY! HI!!!!!!!!!!!!! HOW do you get the Joysnap seeds?! I have the Jangleberry seeds though! :D YOU ARE COOL!

    -kka2297 ^_^

  • 496. kandyriot  |  November 9, 2008 at 2: 53 pm

    frosty do u ever miss dizzywood. SOmetimes it is boring for me but i mean there are alot of really nice people and good friends that make it interesting, and i’m sure you had alot of friends. lol

  • 497. kandyriot  |  November 9, 2008 at 3: 01 pm

    also can u put ur chatbox back up??

  • 498. frosty  |  November 9, 2008 at 6: 46 pm

    *whistles* i guess i miss dizzywood sometimes. but there’s as many good and nice ppl on dizzywood as there is bad and meanie’s people on dizzywood. they balance eachother out… for the chats, no i cant put it back up. why? because
    1. i cant go on them anymore
    2. there really unsafe and i dont want any of u hurt and
    3. i dont feel like it.
    so ya…. bam

  • 499. frosty  |  November 9, 2008 at 6: 49 pm

    oh lol and 4 the person that keeps commenting on here saying that they hate me, my hair is weird, and that i should stop zapping people, well…..uh first of all, i dont know you. second of all, i dont care wat u think of my hair? and lastly, what the fluff why would i zap people repeatedly for no reason??? the nerve of dizzywoodians these days…

  • 500. frosty  |  November 9, 2008 at 6: 50 pm

    btw, hate comments really crack me up,so dont even try to make me feel bad.

  • 501. kka2297  |  November 9, 2008 at 9: 02 pm

    Does anyone have a Joysnap seeds? Please tell me. Do you have a Joysnap Frosty?

  • 502. kandyriot  |  November 10, 2008 at 8: 58 pm

    well I know there are some people who were mean to u but most of them were mean because they were jealous that ur site was so successful. Ya know I checked out 1 girls site who was trashin u (and by the way I stood up 4 u wen she was trashin u) and she had like 4 hits, and there was this other girl who was trashin u (by the way I stood up 4 u again) and she made a site that was like exactly copying u her username was frozti. Anyone who makes fun of u is a Hater or just a mean person.
    P.S. check out my site http://kandyriot.wordpress.com

  • 503. kandyriot  |  November 10, 2008 at 10: 00 pm

    Also u should just ignore anyone who is mean to you. Ya know this tear I’m in seventh and there is this group they pick on everybody, but I don’t let it get to me. And ever since I started to act like I didn’t care instead of like I wanted to be their friend they have been really nice to me. The point of the story is ignore all those haters who are mean to u.

  • 504. em_xoxo  |  November 13, 2008 at 7: 44 pm

    Hey Frosty what up?

  • 505. nicole  |  November 14, 2008 at 2: 48 am

    what is your answer?

  • 506. nicole  |  November 14, 2008 at 8: 48 pm

    what is your password in dizzywood! please tell i will not tell anyone pls

  • 507. blackcat8  |  November 14, 2008 at 10: 58 pm

    Hey Frosty when can u come on dizzywood i’ve always wanted to see you i have questions.

    About clubppenguin I wanna meet you there too plz plz plz!

  • 508. kandyriot  |  November 15, 2008 at 6: 40 pm

    hey u said u were getting tired of posting and stuff so u should hire some other authors (I can do it) so that whenever u don’t feel like posting they can post for u

  • 509. piplup4  |  November 15, 2008 at 9: 26 pm

    in club penguin when do you go on and where caus i would like to meet you

    Username on Club Penguin : smudgiepie

  • 510. friend  |  November 16, 2008 at 8: 10 pm

    hey frosty in the DOJO on club punguin whats all the stuff about ninjas there ……… met me there tomorrow at 5:00 on alaska in the dojo

    club penginn user name is:gothgirl411

  • 511. friend  |  November 16, 2008 at 8: 11 pm

    hey frosty in the DOJO on club punguin whats all the stuff about ninjas there ……… met me there tomorrow at 5:00 on alaska in the dojo

    my club penginn user name is:gothgirl411

  • 512. cheerio710  |  November 18, 2008 at 4: 40 pm

    i really wanna be your friend on dizzywood cause im your 1# fan!

  • 513. Comfycushion1203  |  November 19, 2008 at 7: 49 pm

    u HAVE to make a missions pg.!
    I can’t figure one of them out! :’(

  • 514. ruthie  |  November 21, 2008 at 2: 53 pm

    why did u keep all of ur dizzwood comments and why did u want to go back to bloging

  • 515. frosty  |  November 21, 2008 at 2: 54 pm

    well, why not?

  • 516. cheerio710  |  November 22, 2008 at 9: 04 am

    frosty plzzzzz go on dizzywood i really wanna meet you PLZZZZZZZZZZZ!

  • 517. Sonic  |  November 22, 2008 at 7: 44 pm

    why can’t you go on chatboxes anymore? and why are you angry at me?

  • 518. Sonic  |  November 25, 2008 at 1: 53 pm

    can i be on your blogroll? idk if i asked this already but i won’t be argry if you say no.

  • 519. fluffers1490  |  November 28, 2008 at 9: 16 pm

    PPLZ STOP ASKIN FROSTY ABOUT FRIGGIN DIZZYWOOD SHE QUIT OK!?
    (Sorry frosty…I hate it when this happens and well…I kinda interveened. :oops: )

  • 520. frosty  |  November 29, 2008 at 9: 56 am

    lol its ok fluffy

  • 521. cheerio710  |  November 29, 2008 at 9: 58 am

    yea ur right fluffers its just i really wanna meet her but im sure shes happy playing club penguin! :)

  • 522. CBA  |  November 29, 2008 at 10: 50 pm

    hey frosty remember me?

  • 523. frosty  |  November 30, 2008 at 2: 22 pm

    of course i do =P

  • 524. CBA  |  November 30, 2008 at 5: 35 pm

    r u serious? i havent seen u since christmas tho

  • 525. frosty  |  November 30, 2008 at 5: 57 pm

    yeah i know :/ i remember a lot of things though. no not really…. but i do remember you o.o

  • 526. vinathi  |  November 30, 2008 at 7: 53 pm

    Can I meet on Zany on Dec. 6
    7:30 in Eastern TIme
    Alaska: 3:30
    Pacific: 4:30
    Mountain: 5:30
    Central: 6:30
    GMT / Zulu / UT: 12:30

  • 527. frosty  |  November 30, 2008 at 7: 55 pm

    ill try

  • 528. frosty  |  November 30, 2008 at 7: 55 pm

    except well i dont go on dizzywood anymore

  • 529. vinathi  |  November 30, 2008 at 8: 14 pm

    Actually just email me saying this is frosty.

  • 530. vinathi  |  November 30, 2008 at 8: 15 pm

    sorry i forgot :(

  • 531. vinathi  |  November 30, 2008 at 8: 16 pm

    WOW, U just answered me !!! :D :D :D :D !!! WOW THE FROSTY JUST ANSWERED ME!!!!!

  • 532. vinathi  |  November 30, 2008 at 8: 17 pm

    The second I TYPED IT TOO!!!!!!!!!!!1

  • 533. CBA  |  December 1, 2008 at 4: 29 pm

    (giggles) yeah lol she was prob just on the page when u sent it-

    oh and frosty i know you have quit and all, but i havent seen you in FOREVER! if you ever do come on again (i dont care when) can i meet you somewhere? last time i saw you, you were with waddlez & b4 i could talk to you, yall went to his room, and he deleted me-

    maybe we could meet when vinathi asked to meet you-
    wobbly in edge okay?

  • 534. frosty  |  December 1, 2008 at 4: 40 pm

    *sigh* idk if ill b home but ill try

  • 535. CBA  |  December 1, 2008 at 4: 46 pm

    okay, well it doesnt really matter that much, whenever you can, but if you dont want to it doesnt really matter to me that much

  • 536. cheerio710  |  December 1, 2008 at 5: 11 pm

    frosty?

  • 537. cheerio710  |  December 1, 2008 at 5: 13 pm

    could i ask u a huge favor

  • 538. cheerio710  |  December 1, 2008 at 5: 17 pm

    it would meen the world to me

  • 539. frosty  |  December 1, 2008 at 5: 40 pm

    sure?

  • 540. CBA  |  December 1, 2008 at 6: 35 pm

    lol

  • 541. CBA  |  December 1, 2008 at 6: 36 pm

    umm cheer? u know u can just ask her on meebo, she was just on a sec. ago

  • 542. hey ho  |  December 1, 2008 at 8: 24 pm

    why did u quit dizzywood and start club penguin??

  • 543. horse347  |  December 2, 2008 at 8: 21 am

    Hi Frosty! Its horse345. This is my posting name! ^_^

  • 544. purple230  |  December 2, 2008 at 3: 22 pm

    do u like pie? jw

  • 545. frosty  |  December 2, 2008 at 4: 34 pm

    um….suuuuure i do…

  • 546. em_xoxo  |  December 10, 2008 at 5: 25 pm

    Can you meet me on Dizzywood plz? id probably say like as soon as possible plz plz plz plz plz plz! (XD im retarded)
    but my name on DW is Em_xoxo obviously and ur already on my buddy list so yah.

  • 547. iceman4899  |  December 11, 2008 at 7: 49 am

    I don’t like dizzywood anymore and theres this site called planetcazmo.com which doesn’t get a lot of viewers. Why don’t you show glitches on this blog.

  • 548. ★☆☺Musik-star♫♪☻  |  December 12, 2008 at 1: 01 pm

    Frosty, too bad your not posting any dizzywood cheats anymore but i quitted dizzywood months ago now i like clubpenguin ‘again’ :D

    ~♥♦♥~

  • 549. Sakur123Hinata  |  December 13, 2008 at 3: 03 pm

    HOW DO YOU SWIM WITH GOGGLES?

  • 550. ~chaos9876~  |  December 14, 2008 at 8: 16 pm

    DW Gal Pal, I can answer that question:

    No. Only if you want upgrades and stuff like that you need to pay, so you can make your own blog if u like :)

  • 551. vinathi  |  December 20, 2008 at 11: 08 pm

    What happened to ur chat box?

  • 552. Crysatal97  |  December 22, 2008 at 10: 14 pm

    Why is pie called pie?
    Why is sky called sky?
    Why is water called water?
    (Mwa ha ha haaaaaa)

  • 553. xhere2helpx  |  December 23, 2008 at 12: 12 pm

    Hello Frosty.
    I was wondering…
    What’s that widget called that says how many people are on the site that second? I’d like it for my advice column, http://xhere2helpx.wordpress.com
    Please answer soon!
    Yours Truly,
    Abby ♥

  • 554. frosty  |  December 23, 2008 at 3: 38 pm

    crysatal: ???? what the crap

    xhere2helpx: the widgets called who’s among us or something. you can make them here: http://whos.amung.us/colorwheel/

  • 555. xhere2helpx  |  December 23, 2008 at 4: 55 pm

    Thankyou Frosty ^_^

  • 556. Crysatal97 a.k.a. Crys  |  December 23, 2008 at 5: 59 pm

    Te he he he….. I thought you wouldn’t be able to answer them!

  • 557. frosty  |  December 23, 2008 at 6: 11 pm

    :roll:

  • 558. Crysatal97 a.k.a. Crys  |  December 23, 2008 at 8: 09 pm

    :lol:

  • 559. calv  |  December 25, 2008 at 12: 40 pm

    pie ftw

  • 560. Blucky  |  December 28, 2008 at 8: 47 am

    ook where is the new pin?

  • 561. Blucky  |  December 28, 2008 at 8: 51 am

    wait nvm in the si loge ahhaa

  • 562. oohoohooh  |  December 28, 2008 at 9: 44 pm

    hey email me i need to talk to you in privite plz i need your help

  • 563. someone  |  December 29, 2008 at 7: 32 pm

    hey frosty i want to talk to u meet mr in giddy in the 30

  • 564. frosty  |  December 29, 2008 at 7: 46 pm

    uh what? *im kinda creeped out rite now*

  • 565. vinathi  |  December 29, 2008 at 9: 34 pm

    do you have a twitter ????? O.O

  • 566. calv  |  December 29, 2008 at 9: 40 pm

    *whisper* HEHE

  • 567. calv  |  December 29, 2008 at 9: 41 pm

    MICHAEL!!!!!! x_x

  • 568. JustAdude2  |  December 30, 2008 at 1: 59 pm

    I dont get this…. Why do people say random things For Example “i like pie” its…. interesting that people i like pie
    Its like in a party and there is a fight and it goes quiet and someone screams I like Cheese Whiz!

    JustAdude2+Presents=HAppy JustAdude2

  • 569. chaos9876 (not logged on)  |  December 31, 2008 at 2: 38 pm

    whats the best way to earn coins in club penguin?

  • 570. frosty  |  December 31, 2008 at 3: 55 pm

    cart surferrr….or the paint by letters thing

  • 571. calv  |  December 31, 2008 at 4: 17 pm

    being random makes the world go round and round :D

  • 572. Sonic  |  December 31, 2008 at 4: 19 pm

    CALV DONT FORGET ME CALVVVV

  • 573. vinathi  |  January 1, 2009 at 1: 13 am

    5 QUESTIONS:

    1. Do you have a twitter??
    2. Have you done anything for winter break yet?
    3. I am doing an expeiriment on smileys………. show me all you’ve got :mrgreen:
    4. Do you hate me :cry:

    Ok then maybe 4 :lol:

  • 574. ebony  |  January 1, 2009 at 5: 33 pm

    hi

  • 575. vinathi  |  January 1, 2009 at 7: 35 pm

    Oh yea………. the 5th question was

    5. HAve you done ANYTHING for winter break yet?

  • 576. lipgloss  |  January 8, 2009 at 7: 26 am

    Hey !!! ok im gonna delete my blog if you dont tell me how to
    get my blog fame XD jokes! BUT HOW DID YOU GET IT SO FAMEOUSE!!!

    google adwords stinks like you have to pay !!! :MAD:

  • 577. kka0797  |  January 8, 2009 at 4: 34 pm

    Do you like cookies? Me likez cookies. ^_^

  • 578. lipglossroses  |  January 10, 2009 at 2: 42 am

    Frost! ya so cooooooool!

    __________________________________________________
    Green eyes are so in!

    Friendship is like peeing in your pants , you dont no its thier unless you feel the warmth

  • 579. ♫♥☺HersheyGirl13☺♥♫  |  January 10, 2009 at 9: 00 am

    O.O well anyway….PIE!
    (I’m crazy but thats how I roll)

  • 580. wittywood599  |  January 15, 2009 at 7: 41 am

    frosty do you still remember me?

  • 581. wittywood599  |  January 15, 2009 at 7: 42 am

    i`m your friend in dizzywood i`m bf with piink and many of your friends to !!!

  • 582. 1234sell  |  January 15, 2009 at 11: 05 am

    frosty what ever happened to dizzywood? it used to be dissywood cheats.

  • 583. Sarahe  |  January 15, 2009 at 4: 59 pm

    Hey Frosty,
    What I want to know is WHAT SITE ARE YOU GUYS TALKING ABOUT.BECAUSE I WANT TO GO ON THERE TO.

    BYE,
    Sarahe

  • 584. dreamergirl101  |  January 19, 2009 at 3: 50 pm

    Frosty!
    I need help! I’ve been going to all the cheat sites and they all suck! When you had the site for dizzywood cheats I got through the events easily and I got all the powers and now when I need you most you’re gone! Why Frosty?! Why?!

    -dreamergirl101

    P.S. Why Frosty?! (starts crying)

  • 585. frosty  |  January 19, 2009 at 4: 33 pm

    …yaaa uh how am i supposed to help you now?

  • 586. dreamergirl101  |  January 21, 2009 at 11: 27 pm

    Yeah! ‘Bout that I need help finding the first opal idol ‘cuz dizzywood changed A LOT. So do u know where the first opal idol is?

    -dreamergirl101

    P.S. Onca said to use ghost ray near the cliff side of the river in the Tanglevine Jungle to find the opal idol. Hope that helps! :)

  • 587. dreamergirl101/awesomnes200  |  January 21, 2009 at 11: 43 pm

    I just looked up at the top for the first time and I saw, “do NOT ask dizzywood questions anymore people, i wont answer them. everrrrr. i wont meet you on dizzywood, i wont tell you how to get a bunnycorn,” sooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo,I do have an account on club penguin! awesomnes200! So I’ll just have to come up with a question for club penguin!

    -dreamergirl101/awesomnes200

    P.S. If you figure it out and want to tell me just post it or ask me to meet you in dizzywood or club penguin.

  • 588. lipglossroses  |  January 23, 2009 at 3: 11 am

    I like DW more than CP ….Well nvm not like i wanna meet you (noo offence lolz)

    _____________________________________________________

    Truth is like your shadow, It will follow you …always with you …Your dreams tell the truth .

  • 589. lipglossroses  |  January 23, 2009 at 3: 16 am

    Who likes meat pie ?

    ________________________________________________

    No matter how long whatsoever night is . Dawn will break through the skies- twilight

    ….

    It Is hard to make , when it is easy to destroy -same it is with friedship.

    Hard to make easy to destroy -Unless the person dosent care .

    ………..

    People cant do anything if you don’t care, the only moral thing that is true – Dont care what anyone says , if you dont care there is nothing they can do!

    Holding the hand ; you wont Fall off the cliff

  • 590. lipglossroses  |  January 23, 2009 at 3: 20 am

    LOLZ!!! mani cant believe you dont do the ____________________________________________________

    You only need ONE friend – a true friend .Someone who can support you when people pick on you , someone who can wipe the tears .

    The one True friend’s hand you will need to hold when people try to push you off the cliff, but knowing that your holding the hand , and not caring what people say – You wont fall off.

  • 591. mandaxpanda9  |  January 23, 2009 at 3: 05 pm

    do you have cheats on unlocking items

  • 592. coolshun  |  January 25, 2009 at 11: 33 am

    tch i really need a new worker for cp! since jonasbrothergurl deleted her blog and i went back to cp!
    now i need someone to post about it
    i no u really well…. do i? and how did we met?

  • 593. motomaddy  |  January 29, 2009 at 6: 56 pm

    Hey frosty… Umm is it ok if I put your website on my blogroll?!?!? You can reply on my FAQ page at http://motomaddy.wordpress.com/ Thanks!
    MOTOMADDY

  • 594. crystal7337  |  January 31, 2009 at 9: 23 am

    how do u get into the onkasi treasure rooms

  • 595. crystal7337  |  January 31, 2009 at 9: 25 am

    lipgloss roses i no u ive seen u at dizzywood today!!!!

  • 596. zaria 8  |  February 1, 2009 at 6: 41 pm

    hi frosty please anwer im on my fouth room scroll where can i find it?

  • 597. b3v1n  |  February 6, 2009 at 4: 11 pm

    Hey frosty. I was just letting you know that I’ll be adding you to my blogroll. It seems only yourself &Fluffers has been updating about Dizzywood. Feel free to add me to your blogroll if you want.

    B3V1N.

  • 598. ewardfromtwilight  |  February 13, 2009 at 3: 34 pm

    hay how do i get rid of the purple stuff on me from the canal city??

  • 599. frosty  |  February 13, 2009 at 4: 06 pm

    go into the deep water at the beach

  • 600. wittywood599  |  February 14, 2009 at 8: 25 pm

    frosty if you see me in dizzywood pls be my friend my name there is wittywood599

  • 601. wittywood599  |  February 14, 2009 at 8: 26 pm

    plssssssssssssssssssssssssssss!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! answer

  • 602. Smiley_mee  |  February 16, 2009 at 2: 20 pm

    How do I get the two ghost opal idols? I used the ghost ray at the pillar at the lower right at Onca but there but there wasn’t anything behind it and whenever I dig the rocks at Jaguar temple I could see the ghost opal idol but I cant pick it up. All I get is 200 coins.

  • 603. frosty  |  February 16, 2009 at 3: 14 pm

    at tanglevine jungle did you play the blue ghosts game and win? i think thats how you get the other idol and maybe once you get that you can get the second one under the rocks. i dont know i got zap a differnt way during beta testing

  • 604. wittywood599  |  February 18, 2009 at 6: 30 am

    why dont you always answer my question!?

  • 605. scroll1  |  February 18, 2009 at 8: 54 am

    hi peoplez!!!

  • 606. Smiley_mee  |  February 19, 2009 at 4: 12 pm

    I tried that already. I played the game with the ghost guy and I won but he only gave me coins.

  • 607. Jojololly789  |  February 20, 2009 at 6: 28 pm

    umm hey jojololly here (im ur friend frosty :) ) i wanted ot noe even though i dnt have a blog can i work for u im lookin for a dizzywood blog that i can work on

    thx a bunch
    jojololly789 o(**)o

  • 608. 19happines981  |  February 20, 2009 at 10: 54 pm

    frostyu r the luckiest person because ppl actually go on ur webby nobody goes on my webby. :( ur webby i like a million hit song na gmy webby is like a broken record!

  • 609. fayeelorza  |  February 21, 2009 at 2: 03 am

    how can we get in canal city?

  • 610. Smiley_Mee  |  February 21, 2009 at 9: 56 pm

    how do you get the ghost opal idols for zap? you already replied to me. you told me to challenge the blue ghost guys at tanglevine jungle, but I did that already. he only gave me the coins and you didnt tell me anything about the one at the rock pile in jaguar temple. whenever i dig up the rock pile in jaguar temple I see the ghost opal idol but when I try to pick it up I get 200 coins instead of the ghost opal idol.

  • 611. zaria8  |  February 22, 2009 at 6: 56 pm

    smiley_mee im going to give u your anwser well frst there is this piller next to onca use ghost ray on it then u get the frist idol then use invisabley to get into the jagwar temple then use levation to go platu to platu then find a pile of Stuff click it untill u get the idol then go to the big face thingy click on it and volia! u have zap hope it helps :)

  • 612. lillysinger  |  February 23, 2009 at 1: 00 am

    hey frosty got any neat cheats for gettin critters cos i gots nun!?

  • 613. wittywood599  |  February 25, 2009 at 6: 04 am

    can i be a worker here? please!

  • 614. ref678  |  February 28, 2009 at 10: 59 am

    teh iwanted to know wen will canal city open! and how do u teleport?!!!

  • 615. frosty♥  |  February 28, 2009 at 12: 31 pm

    idk when it will open…?
    and what do u mean teleport?

  • 616. kindlady  |  February 28, 2009 at 8: 48 pm

    can u make me a gold member

  • 617. flora456  |  March 4, 2009 at 6: 00 pm

    KINDLADY! stop asking ppl to make u gold do it ur self! ask ur mom and dad ok? stop asking others for there gold accounts i saw u do that u asked flora678 for her pass! mm hmm

  • 618. wittywood599  |  March 4, 2009 at 7: 39 pm

    can i be a worker here?

  • 619. stephy  |  March 11, 2009 at 4: 06 pm

    frosty, how are you able to get to do hair? I HAVE THREE THOUSAND $$$$$!!!!

    frosty: you have to be at least a silver member, if you are then follow this: http://frosty1297.wordpress.com/2008/06/14/new-powers/

  • 620. Hollowlog  |  March 15, 2009 at 10: 20 am

    Hi Frosty, and I was just wondering, can I be a worker here? I played dizzywood for 2 years already, and I want to help the dizzys.

    frosty: uhm first of all, dizzywood hasnt been out for 2 years. second of all, i dont need any more workers. especially if they lie…jeez.

  • 621. hollowlogsdizzywoodcheats  |  March 15, 2009 at 12: 55 pm

    Wait, who’s that hollowlog person? I’m hollowlog. Number 620 is a copycat! :O

    frosty: dude your IP address is the same, so you just lied again. yeah have fun with that.

  • 622. wittywood599  |  March 16, 2009 at 3: 50 am

    hi frosty can i see you on saturday?

  • 623. coolshun  |  March 17, 2009 at 2: 48 pm

    Can i work for u?
    I copy jjtts pictures for some reason ulln me bloggy see on me bloggy

  • 624. dreamergirl101  |  March 17, 2009 at 4: 28 pm

    hey frosty!
    ur back!
    YEAH!
    ok here is my question:

    Where is the leprechaun?

    Plz answer this question asap!
    This activity only lasts until midnight! (but answer this question before 6:00 p.m.) kk? kk!

    -dreamergirl101

  • 625. coolguy99  |  March 17, 2009 at 7: 53 pm

    frosty how do you finish the mission help it hatch?
    its ok if you dont know…
    frosty could i be your buddy on dizzywood?
    im 1 and a half years old on dizzywood.
    and i just turned 13.

  • 626. coolguy99  |  March 17, 2009 at 7: 54 pm

    btw my computer sucks…

  • 627. coolguy99  |  March 17, 2009 at 7: 55 pm

    my computer sucks so i might not saying anything for a while if you see me..

  • 628. flame543  |  March 19, 2009 at 2: 23 pm

    ^_^ (: :D (:O LOL i love making funny faces!!!:P!!!!!!:O

  • 629. flame543  |  March 19, 2009 at 2: 24 pm

    ^_^

  • 630. flame543  |  March 19, 2009 at 2: 26 pm

    how do u do those moving smily’s??????? :P ???????:”””(?????:d??

  • 631. flame543  |  March 19, 2009 at 2: 26 pm

    :*(?

  • 632. ydoggy  |  March 20, 2009 at 9: 45 pm

    RANDOM QUESTION OF THE WEEK: Can I work for you and eat all you icecream? lol

  • 633. ydoggy  |  March 20, 2009 at 9: 46 pm

    :”(

  • 634. dragongirlrocksdw28  |  March 23, 2009 at 10: 07 am

    Hey frosty this is DragonGirl28 from dizzywood and I would like to work for you. I have a wordpress website and its http://dragongirlrocksdw28.wordpress.com/ i just started. PEACE OUT~DragonGirl

  • 635. funnygirl74 from dw  |  March 26, 2009 at 6: 25 pm

    hey its me funnygirl from dizzywood if see me plz dont try to add me becouse my buddy list is full and it gets anoying :D just saying other than that if u know me im the weardest and funniest person u no ino ino i talk to much but im realy bored and frosty in dizzywood is ur name frostylala becouse i think i saw u before

    ps: just a joke- first coment not realy but lol ;D

    cya!

  • 636. frosty♥  |  March 26, 2009 at 6: 26 pm

    uhhh
    no its just frosty

  • 637. one not-so tough cookie  |  March 26, 2009 at 9: 09 pm

    ow! i hurt everywhere! we did wrestling 2day! in school! catholic school!

  • 638. one not-so tough cookie  |  March 26, 2009 at 9: 10 pm

    and now i am on dizzywood

  • 639. ♥CBA♥  |  March 26, 2009 at 10: 59 pm

    frostylala :mrgreen: thats a keeper xD

  • 640. frosty♥  |  March 27, 2009 at 1: 52 pm

    heehee cba ^^
    yeah, i wish it was 1 of my accounts though. works with my name 2

  • 641. awesomenessshellz  |  March 28, 2009 at 12: 46 pm

    hey frosty! i got a question ’bout wordpress:

    how do u change ur avatar like u hav the avatar ‘one tough cookie’?

    and

    how do u get the big avatars on ur main page?

  • 642. kkbug96  |  March 28, 2009 at 6: 55 pm

    hey i have a question how do you set up your page on wordpress?lol
    i think that i go on like a myspacee layout thing to get it but idk how…answer back
    Asap!

  • 643. kkbug96  |  March 28, 2009 at 11: 47 pm

    Hey…again..: / i was wandering if i could be one of your workers..? i just not that good at bloggin by myself…

  • 644. karategirl11  |  March 29, 2009 at 4: 46 pm

    what are the answers to the pathfinder test i can’t get the third question. i try and try but i really need some help. can you help me here.

  • 645. kkbug96  |  March 29, 2009 at 7: 57 pm

    lalala (sing sing sing) (sings frosty the snowman lalala)

  • 646. funnygirl74 from dw  |  March 30, 2009 at 6: 59 pm

    ok thx!

  • 647. kkbug96  |  April 3, 2009 at 7: 39 pm

    bored…tehe:)
    btw i deleted my blog
    cuz i suk at it!
    lol

  • 648. kkbugsdizzywoodcheats  |  April 3, 2009 at 10: 54 pm

    I have a Q. how do i get workers??
    :)

  • 649. kkbugsdizzywoodcheats  |  April 3, 2009 at 11: 02 pm

    i want to meet you frosty! how about …hmmm…ummm…emmmm..(cough)….(falls asleep)..ok
    i got it
    Saterday April 4th at 11:30am or maybe tonight cuz i am on..i usally get on giggly but we can meet on wobby..in prestos edge:)
    I will c you there!
    If you cant jst say…cuz i get on anyway and i can ask stokedd if u are on cuz she is my bfriend!
    ~kkbug96~

  • 650. one not-so tough cookie  |  April 7, 2009 at 12: 24 pm

    hey Frosty

    can i be 1 of ur workers? im really creative! plz plz plz plz plz.
    plz answer back.

    ~one not-so tough cookie

  • 651. one not-so tough cookie  |  April 9, 2009 at 4: 11 pm

    hey frosty,

    go to this link:

    plzzzzzzzzz
    say yes

    but tell me, didja like it?

    ~one not-so tough cookie

  • 652. one not-so tough cookie  |  April 9, 2009 at 4: 13 pm

    AAAAAHHHHHHHHHHHH the link is gone…

  • 653. one not-so tough cookie  |  April 9, 2009 at 4: 15 pm

    http://www.slide.com/r/JV31LO336D8svDvDzUpppMAi4qdhzNgl?previous_view=mscd_embedded_url&view=original

    here the link is^^^^
    copy and paste it into ur url

  • 654. one not-so tough cookie  |  April 9, 2009 at 4: 15 pm

    weird…

  • 655. one not-so tough cookie  |  April 10, 2009 at 11: 55 am

    its here…
    i mean there…

  • 656. frosty♥  |  April 10, 2009 at 12: 08 pm

    uhm well.
    i dont hire workers when i barely know them. i dont even let my closest friends work 4 me. i like doing it on my own, but when i need help i got it. so i dont need any help…

  • 657. Chaos :P  |  April 10, 2009 at 12: 40 pm

    hi frosty

    the cp easter egg hunt has started and if you find all of them please respond

  • 658. ydoggy  |  April 10, 2009 at 3: 50 pm

    closet friends? lol thats wat i thought u put um and will u work for my site i need help since i have to *glares at history progect* do my history progect if u want to work for me just post a commenet on my site http://99faulkner.wordpress.com/ but i need to go to know first http://99faulkner.wordpress.com/

  • 659. Anonymous  |  April 10, 2009 at 4: 03 pm

    GUESS WAT IF UR “LOYAL” AND NOT GOLD U CAN BUY A GOLDIE MEMBERSHIP FOR A BUCK

  • 660. greenpriness  |  April 11, 2009 at 9: 37 am

    THAT COMMENT A BOUT THE GOLDIE MEMBERSHIP FOR BUCK was by me

  • 661. Chaos :P  |  April 11, 2009 at 10: 16 am

    nvm i found all of the eggs in cp

  • 662. j  |  April 12, 2009 at 8: 06 pm

    how do u do the puzzle slider in the endlesswild?

  • 663. Lipgloss5656  |  April 13, 2009 at 5: 56 pm

    Do you have a Twitter?(mine is http://twitter.com/roxxmysoxx )

  • 664. Lipgloss  |  April 13, 2009 at 10: 18 pm

    umm………… I like pie . And frosty the people that say bad stuff about you are jealose and they are lame and just tease you cuz there jealose so dont listen to them your pretty good for a celebrity ! :) And i quit DW too :) Because of Silver :)

    ______

    dogs barking at the new moon , so that they could fly (fly )

    Flames to dust lovers to friends , why do ALL good things come to an end OOH! Come to an end , come to an end!! ;( that song make my cry!

  • 665. Aloha123Puss  |  April 14, 2009 at 9: 28 pm

    FROSTY IS AWESOME CUZ SHE IS SO COOL

  • 666. JLIGHTNING/HOLLY  |  April 19, 2009 at 1: 41 pm

    HI FROSTY I SAW U AT DIZZYWOOD TODAY (SUPRIZE) AND I ASKED U IF U HAD A BLOG IS THAT U????????????????????????? WELL I ALSO ASKED U (WELL MABE U) IF I COULD (MABE U) BE UR FRIEND………………….OH AND CAN U PLZ TELL ME HOW TO SEND THINGS TO DIFF. PEOPLE BECAUSE I HAV FRIENDS THAT R NOT GOLD AND THEY WANT ME TO SEND THEM SOME OF MY CLOTHES OR PETS AND STUFF LIKE THAT………. SO BBYYYYY OH YEAH AND SEE U AROUND…………

  • 667. JLIGHTNING/HOLLY  |  April 19, 2009 at 1: 44 pm

    U R SOOOOOOOOOOOOOOO COOOOOOOL AND I GO ON UR BLOG A WWWWWWWWWWWWWWWWWHHHHHHHHHHHHHHHHHHHHHHHOOOOOOOOOOOOOLLLLLLLLLLLLLLLEEEEEEEEEEEEEEE BUNCH

  • 668. Anonymous  |  April 22, 2009 at 11: 29 pm

    …

  • 669. Anonymous  |  April 22, 2009 at 11: 32 pm

    don don a don don dan dan!

    ooooooooooooooooooooooo

    ahhhhhhhhhhhhhhhhhhhhh

    i a blank person,

    lets c wat happens when i
    post the comment!

    o btw, its one not-so tough
    cookie!

  • 670. Coolieperson  |  April 26, 2009 at 6: 39 pm

    uh hey…

    well 1st…
    1. no im not a poser coolieperson,
    2. im not here 2 cuss u out…

    i dont like being on here like some obsessed 6 year old and stuff….but i totally forgot how to take pix of the computer screen. i need it for my myspace lol. i thought i was alt + prt scr….but we have a new laptop(windows vista) and i forgot lol. i didnt know who else to ask cuz none of my friends are on the computer all the time…soo ya. thanks.

  • 671. frosty♥  |  April 26, 2009 at 7: 07 pm

    uh hey…
    well 1st…
    1. i highly doubt ur rly coolieperson
    2. ur ip address isnt the same either

    but you do sound like her :/ still insulting us i guess. well i only use alt print scn, u press them at the same time. but uhm isnt there a help thing u can go to?? anywayssss if it really u, sonic has been obsessing since foreva trying to find ur myspace :/ have fun

  • 672. abbey  |  April 26, 2009 at 10: 47 pm

    first of all whats url??????????
    but this is the real question………..
    i have my blog and every thing but i do not no how to put stuff on it
    plzzzzzzz tell me
    and u r awesome

    p.s im tring to make a website about
    miley cyrus

    a dw charecter Abbey Underwood

  • 673. Coolieperson  |  April 27, 2009 at 9: 27 pm

    Like I said, I got a new laptop. so my ip isnt the same. honestly i just dont know why your on here. but im done insulting you. to be honest…..i was pmsing LMAO soo ya. but im sorry.

    whats your chatbox thingy? i might go on once in awhile. we can be like pen pals if u want :) .

    frosty: well okkkkk. i cant go on chatboxes anymore, i havent been on them for over half a year. and sonic…has some uh issues.

  • 674. Coolieperson  |  April 27, 2009 at 10: 23 pm

    btw tell sonic, im sorry, but i dont wanna add someone who ive never met in person on my myspace. we can talk on chatboxes.

  • 675. Coolieperson  |  April 28, 2009 at 7: 33 pm

    y not? o well. and ya i kinda figured that from the start lol….i might go on here once in awhile….bye for now lol

    PS o god i accidentaly typed fingered instead if figured 1st……yikes.

    frosty: sick thoughts D:

  • 676. frenchfries  |  April 30, 2009 at 4: 31 pm

    i have an important ( sorta) question ……… sometimes on dizzywood ur a boy and somethimes ur a girl so……….
    r u a BOY or GIRL !!??!!??!!??

  • 677. frosty♥  |  April 30, 2009 at 4: 33 pm

    when the heck have i ever just randomly became a guy on dw?

  • 678. frenchfries  |  April 30, 2009 at 4: 44 pm

    IDK WELL I JUST FOUND OUT ABOUT THIS SITE HOW WAS I SUPPOSE TO KNOW ( no reason to be mean about it

  • 679. frenchfries  |  April 30, 2009 at 4: 48 pm

    so … ur a boy cause people say ur a boy then other people say ur a girl

  • 680. frosty♥  |  April 30, 2009 at 4: 59 pm

    gahhh who says im a dude

  • 681. frenchfries  |  April 30, 2009 at 5: 04 pm

    so u R a girl

  • 682. frenchfries  |  April 30, 2009 at 5: 06 pm

    EVERYONE SAYS UR A BOY

  • 683. ydoggy  |  April 30, 2009 at 5: 56 pm

    coolie thought i was a boy till we finally met on dw she was like whaat u r a girl and im like ya duh

  • 684. Lizzy  |  May 2, 2009 at 6: 35 pm

    I CAN NEVER WIN THE WILD MORPHER SLIDER GAME! HOW DO I WIN!!!!

  • 685. frosty♥  |  May 2, 2009 at 6: 42 pm

    get all the pieces aligned just like in the picture to the bottom right. there’s no cheats to it or anything, its just luck and skill.

  • 686. annamh  |  May 2, 2009 at 8: 56 pm

    HI __ __
    ____ ____
    _____________
    ______________
    _____________
    ____________
    _________
    _______
    _____
    ___
    _

  • 687. ♥ღ♥Everest120♥ღ♥  |  May 3, 2009 at 1: 45 am

    How did u get so popular?!?!? It’s like every time someone says “frosty” someone else goes “OMG WHERE?!?!?” lol :)

  • 688. ~coola13~  |  May 3, 2009 at 2: 41 pm

    how do u get the fancy stuff bi ur name

  • 689. molly  |  May 5, 2009 at 8: 34 am

    How do you customize (change the font and colour) your name and speech bubbles when you are a gold explorer?? please reply!

    frosty: there’s a mission to get the new power.

  • 690. softiegirl  |  May 5, 2009 at 10: 38 am

    uhm well i wanna make my own cheat site [either dizzywood or club penguin][probably dizzywood]how do i do it i already have a wordpress

  • 691. softiegirl  |  May 5, 2009 at 10: 40 am

    how do i make mi own cheat site [i already have a wordpress]

  • 692. softiegirl  |  May 5, 2009 at 10: 41 am

    how do i get a cheat site i already hav a wordpress!!!!!!!?????????

  • 693. softiegirl  |  May 5, 2009 at 10: 43 am

    i wanna have a cheat thinggy i already have a wordpress. . .HOW!?

  • 694. POSER!!  |  May 6, 2009 at 11: 01 pm

    hi there bestest pal um.. can i ask what is the first letter of your password?

    frosty: no. cuz idk you. freako..

  • 695. fluffers1490  |  May 8, 2009 at 10: 01 pm

    POSER!! You’re like, majorly a freakish stalky person. 0_o

  • 696. piink  |  May 8, 2009 at 11: 54 pm

    im not a poser frosty and especially not a freako and answer my question:what is the first letter of your password?

    frosty: pffft.

  • 697. vella  |  May 10, 2009 at 8: 01 am

    where do u get a critter

  • 698. flame543  |  May 10, 2009 at 1: 36 pm

    HOW DO U MAKE THE MOVING SMILEY FACE (or if its giggle srry)

  • 699. piink  |  May 11, 2009 at 12: 17 am

    question:what is the first letter of your password?

    frosty: OMG WOULD U STOP! i know ur not piink idiot and even if u were i wouldnt tell you that, cuz i dont even know. now shut. up.

  • 700. flame543  |  May 11, 2009 at 4: 19 pm

    frosty even though i didnt ask u what the first letter of u pass… just dont yell i }{ate it when peepz get mad :cry:

  • 701. Chaos9876  |  May 11, 2009 at 6: 36 pm

    omg stalky poser!!!0.o 0.o 0.o 0.o 0.o def not piink -.- frosty isnt stupid whoever-you-are.

    l|l|l
    T.T

  • 702. frosty♥  |  May 11, 2009 at 6: 56 pm

    arghhh!! its online im not yelling. my god.

  • 703. one not-so tough cookie  |  May 11, 2009 at 10: 05 pm

    ღ♥

  • 704. one not-so tough cookie  |  May 11, 2009 at 10: 06 pm

    i was bored so i put a random pic there…

  • 705. one not-so tough cookie  |  May 12, 2009 at 12: 12 am

    y is there a poser of piink trying to get frosty’s first letter of her pass.? that is just stupid…

  • 706. dizzycorny  |  May 12, 2009 at 9: 28 pm

    Cornydude: Can I work for u?

    Frosty: Yes

    Cornydude: Yay

    Make this happen
    frosty: no. rejectedddd

  • 707. one not-so tough cookie  |  May 12, 2009 at 9: 47 pm

    um… frosty y isnt waddlez working 4 u anymore?

    frosty: how would you know he isnt and thats NONE of your buisness.

  • 708. ydoggy  |  May 13, 2009 at 7: 08 pm

    frosty♥ said

    arghhh!! its online im not yelling. my god.

    Ydoggy says

    frosty is pirate u cant hide nothing from me frosty hahaha im gonna spread it around that u r a pirate

  • 709. the cookie monster  |  May 14, 2009 at 12: 01 am

    1. Okat whoever asked for Frosty’s pass posing as Piink, Frosty’s not stupid. There’s a new invention called an IP Address, you should look up it’s defenition next time you want to do a bad impersonation of someone with a life, which obviously you don’t have.

    2. Corny if you think acting like a jerk is going to get anyone to listen to you, you’re wrong. Firstly, I doubt you even know her that well, you probably just want to work here because it’s a popular blog. Secondly, “make it happen” isn’t going to get you a job on anyone’s blog, I suggest you try “please” instead.

    3. Even though typing in all caps is considered yelling, it IS just a computer, so it’s not really yelling. And she had reason to yell, I bet you would too if someone impersonated your best friend and continuously tried to get your password.

    4. Lol it’s actually kind of funny how pathetic people are willing to act for something as stupid as a password for a virtual kids’ site or a job on a stranger’s blog.

  • 710. the cookie monster  |  May 14, 2009 at 12: 03 am

    I meant okay not okat. Typo. -.-

  • 711. piink  |  May 14, 2009 at 4: 40 am

    hi again frosty i was just testing you! hehehe

    sorry bout that and please i am not a poser

  • 712. piink  |  May 14, 2009 at 4: 44 am

    and frosty who is the most hated person you think is in this list below:

    wittywood599

    helixtreme

    dizzycorny

    please comment back

  • 713. frosty♥  |  May 14, 2009 at 3: 24 pm

    my god. u are SUCH a poser and if you dont stop these ridiculous rude and stupid comments i am going to block you from my site. shuttt uppp.

  • 714. Chaos9876  |  May 14, 2009 at 6: 04 pm

    psh that “piink” or whatever the name is is a poser (that ‘is is’ part may be a bit confusing)

    and the most hated person would be the fake piink because people aren’t stupid. they know who the fake person is and who the real person is. and the first letter of frosty’s password? the most hated person? what kind of comments are these? ones to fill up your list about everybody? seriously, what frosty said, you need to stop posting rude and stupid comments.

    sorry if i went overboard i just am kinda angry :mad:

  • 715. frosty♥  |  May 14, 2009 at 6: 07 pm

    i dont even know my password.

  • 716. Chaos9876  |  May 14, 2009 at 6: 14 pm

    i forgot ot one time so i just typed lollipops :3 i figured that my pass was actually poplolli but i changed it :P

  • 717. one not-so tough cookie  |  May 15, 2009 at 3: 36 pm

    srry frosty! i didnt no ur so sensentive!! ugh!! i just wanted to no wat happened to waddlez becuz i didnt c his name on ur worker thing.

  • 718. one not-so tough cookie  |  May 15, 2009 at 3: 40 pm

    srry that i said that frosty, im in a bad mood…

  • 719. one not-so tough cookie  |  May 15, 2009 at 3: 42 pm

    how do u get to farthings meadow?
    frosty: click the presto’s picnic sign in presto’s edge

  • 720. Anonymous  |  May 15, 2009 at 8: 00 pm

    hi meet dw2009 at Presto’s Picnic to be my friend

  • 721. one not-so tough cookie  |  May 16, 2009 at 11: 53 am

    yea when i completed a mission it let me in!

  • 722. TheChosenOne543  |  May 17, 2009 at 3: 39 pm

    Hey umm Frosty do you know how to get a rainbow emote?

    frosty: its in a gold mission.

  • 723. poptikel  |  May 18, 2009 at 9: 36 am

    is this BLOG or WEBSITE?

  • 724. frosty♥  |  May 18, 2009 at 3: 30 pm

    why would that matter?

  • 725. fudgyswirl  |  May 18, 2009 at 5: 24 pm

    what’s the name of the mission to get the rainbow emote? i don’t think i have it

  • 726. frosty♥  |  May 18, 2009 at 6: 37 pm

    color drops or moonpebbles rainbow~ it could be called both its differnt sometimes

  • 727. fudgyswirl  |  May 18, 2009 at 6: 42 pm

    i don’t have it… i think it was a temporary mission
    frosty: maybe it will come later once you’ve finished most of your missions

  • 728. wittywood599  |  May 19, 2009 at 7: 25 pm

    hey who ever put me in the most hated person i think

    you are mymost hated person…….

    sorry about that people i am just so irritated bout it…

    and hi frosty big fan of your blog

  • 729. vhbfgjgdhk  |  May 20, 2009 at 5: 52 pm

    come on plz frosty.!!!!!!!!!!!! :)

  • 730. vhbfgjgdhk  |  May 20, 2009 at 5: 56 pm

    plzzzzzzzzzz frosty tell me when you come back online and check ill be on dizzwood ok and bye i go to dizzywood.com and lps.com and nicktroplise.com and fantage.com and barbiegirls.com and panfu.com and fantage.com and fushionfall.com its fun trust me ppppppppppppppplllllllllllllllllllllllllllllllllllzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz P.S i never saw you on dizzywood before.

  • 731. vhbfgjgdhk  |  May 20, 2009 at 5: 58 pm

    sorry i said fantage.com to many times oh and i play funkygirl.com

  • 732. ♥ ~chaos~ ♥  |  May 24, 2009 at 11: 27 am

    um… okk then

    …

    anyway….

  • 733. janh  |  May 30, 2009 at 12: 53 pm

    frosty,
    do u know wat the mysterious crate at garden gazebo is supposed to do?
    and… wat do i do with my explorers key?

  • 734. frosty♥  |  May 30, 2009 at 1: 14 pm

    …what mysterious crate
    and i think the explorers key was for a mission or to get some place that u cant go to now. idk.

  • 735. janh  |  May 30, 2009 at 1: 51 pm

    thx frosty

  • 736. jjjlovejobros  |  June 2, 2009 at 3: 23 pm

    hey frosty,

    what color r my socks, or am i wearing socks o.O

    MWAHAHAHAHAHHAhA

    sorry i just ate a lot of sugar… and i am hyper…..

    :D
    :D
    :D
    :D
    :D

  • 737. jjjlovejobros  |  June 2, 2009 at 3: 26 pm

    were did the ABP page go?

    was it not successful?

  • 738. jjjlovejobros  |  June 3, 2009 at 11: 22 am

    ♥

    :mrgreen:

  • 739. jjjlovejobros  |  June 3, 2009 at 6: 18 pm

    how do i put a meebo chat box in my wordpress account

    PLEASE HELP ME!!

  • 740. one not-so tough cookie  |  June 6, 2009 at 11: 11 am

    y cant i talk?

  • 741. one not-so tough cookie  |  June 6, 2009 at 11: 12 am

    yh! now i can talk!

  • 742. witchp11  |  June 7, 2009 at 9: 17 am

    hi i am gold for a month and i dont know how to put my writting fancy!! if its a mission whats its name?? plz hellp me out frosty !!!

  • 743. frosty♥  |  June 7, 2009 at 1: 32 pm

    its called “Recover the Name Styler”

  • 744. witchp11  |  June 8, 2009 at 1: 49 pm

    what if i dont have that mission?

    frosty: you complete missions until you get it?

  • 745. bluemist1  |  June 8, 2009 at 7: 22 pm

    hi im wondering where the whisper weed seeds are cause i need them and all the sites i get on show the wrong type so help and can i be you’re buddy on dizzywood? cause i love you’re site it wood be cool to have u as a friend so please! and i promis not to ask on dizzy wood for mission help only on this k? but only if i lookt every where for the things i need for one (mission) ill only ask you then and i get on every day on server breezy

  • 746. Littletwotwolov8  |  June 10, 2009 at 9: 55 am

    how do you walk on water? plz tell me

  • 747. rr44  |  June 10, 2009 at 10: 05 pm

    frosty do u like hawaii? have u ever been there? i just wanted to know, and it’s actually not that random.
    (okay it kind of is :D )

  • 748. Taloola1  |  June 12, 2009 at 11: 43 am

    Hi! look how can I get in on all the events and win?! I want to!

  • 749. amber6/7  |  June 12, 2009 at 12: 20 pm

    where is the treehouse guide?

  • 750. dhanya  |  June 13, 2009 at 6: 00 am

    Frosty how do i get a fishing pole? please help me .Also how do i get a bunnycorn?

  • 751. coco  |  June 13, 2009 at 9: 50 am

    uh well (+_+) i know its nice meeting u uh i want to say ONE THING PLZ ANSER ok w…www…well… uh um can you tell me where the snake is? Is it in prestos egde? tangle vine? prestos grove? ill ask you a qestion ever day mabey and im only 8!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!SO PLZ ANSER

  • 752. frosty♥  |  June 13, 2009 at 12: 45 pm

    uhm…explorers camp?

  • 753. janh  |  June 13, 2009 at 6: 01 pm

    thx for ur help!
    plz tell me how to win the last crystal badge. which missions do u go on?

  • 754. ydoggy  |  June 13, 2009 at 7: 24 pm

    frosty frosty frosty where did i ever go wrong lol heres my question

    if u have a certain amount of pets and u have a a certain amount of cages if u put 1 pet in each cage there would be 1 too many pets if you put 2 pets in each cage there would be 1 cage left how many pets and cages are there?

    u can also use this for a contest but i wont be able to enter since i know the answers if u use at as a contest ill send u the answer but dont post the comment with the answer

  • 755. koko56  |  June 14, 2009 at 6: 12 pm

    so confusing ydoggy! Ugh! I think i just got a headache

  • 756. music_girlz123  |  June 15, 2009 at 10: 21 pm

    plz plz plz help me find omega beet mine :(

  • 757. ydoggy  |  June 16, 2009 at 11: 55 pm

    hehe it’s my job koko to make me confused and annoyed no seriously i get payed there is an answer too it i promise

  • 758. lotsofluck29  |  June 18, 2009 at 1: 08 pm

    the number of pets has to be one larger than the number of cages. the number of cages has to be even the number of pets has to be odd. but other than that it could be any number.
    some of the answers are (but are not limited to)
    pets:3 cages:2
    pets:5 cages:4
    pets:7 cages:6
    pets:9 cages:8
    pets:11 cages:10
    etc…

    am i right? i tried to work it into an algebraic equation but there wasnt enough data.

  • 759. ydoggy  |  June 18, 2009 at 8: 54 pm

    thoes r all wrong lotsofluck

  • 760. ydoggy  |  June 18, 2009 at 8: 54 pm

    omg i meant ppl not me lol

  • 761. harmony38  |  June 21, 2009 at 12: 10 am

    hey frosty I love your website. I would like to meet you on dizzywood sometime so just tell me when.

  • 762. harmony38  |  June 21, 2009 at 12: 11 am

    hey frosty I love your website and I would also like to meet you sometime. Just tell me when and hopefully we’ll get to know each other better :D

  • 763. harmony38  |  June 21, 2009 at 12: 20 am

    I posted a question for you but it’s on the page about you so be sure to check it out

  • 764. isdf  |  June 22, 2009 at 9: 30 pm

    of frosty here is this weeks um cheat i got it for u cause u not on dw that much so i have ur back

    >>This is a new Gold Explorers only mission on Dizzywood. Color War is about to start and a rock bogie stole one of the crates. Your job is to get it back. The missing crate is in Breakwater Beach. It’s over to the right near where the Sea Sprite is. Click on the crate and you will need to win a game of Combo Drop. This is an easy version of the game where all you need to do is make 30 moves. It doesn’t matter how many points you get or how long it takes you. When you finish, the mission is complete and you get 300 coins. <<

    ——————————————————————————–

    frosty: …i already did the mission myself and kka posted it on my site. but thanks.

  • 765. xxcastawayxx  |  June 23, 2009 at 2: 28 am

    frosty, have you figured out how to do the top model break-in mission on fantage? I can’t get it….

    frosty: yeah i did it, want me to post a mission guide 4 u?

  • 766. harmony38  |  June 23, 2009 at 9: 41 pm

    How do you get paid for annoying someone? It does not make sense at all….

  • 767. xxcastawayxx  |  June 23, 2009 at 10: 43 pm

    sure that’d be awesome!

  • 768. invisible123  |  June 24, 2009 at 3: 29 am

    frosty where will i go to the forest how frosty and how old you are im 8

  • 769. invisible123  |  June 24, 2009 at 3: 32 am

    frosty this cheat for the .com and you how to steal clothes-to do it is go to someones closet pick somthing you like and change your hair style and then log out or sign out and ta-da it is still there ta-da ah ta-da

  • 770. islandgirl14  |  June 24, 2009 at 6: 01 am

    hi frosty wanna be your friend really alot so can you please reply and tell me anytime when you want to meet me

  • 771. frosty♥  |  June 24, 2009 at 6: 31 am

    huh?? and im 13.

  • 772. calv  |  June 24, 2009 at 9: 55 am

    Orly

  • 773. thebugg23/Alice/Bugg {not logged in}  |  June 25, 2009 at 1: 06 pm

    Hi Frosty, I think we’re both on the same color war team..Red right? Cool…I used to know you…And i wanna hang out with ya ^.~ I’m not sure you remeber me at all….^^ Well (maybe) see you in dw ^.~
    ~Buggy

  • 774. frenchfries  |  June 28, 2009 at 3: 31 pm

    if you want to make another account can you delete your old one?

  • 775. frosty♥  |  June 28, 2009 at 3: 32 pm

    i dont think you can ever delete, you could contact the game makers though and ask.

  • 776. calv  |  June 28, 2009 at 7: 05 pm

    did you EVAR eat my waffle.

  • 777. frosty♥  |  June 28, 2009 at 8: 03 pm

    oh yesh. i do lurve waffles…

  • 778. joejonas8151989  |  June 29, 2009 at 8: 12 am

    did u EVAR eat my gummy bears

  • 779. frosty♥  |  June 29, 2009 at 9: 28 am

    …*eh em* No.

  • 780. invisible123  |  June 29, 2009 at 10: 34 am

    frosty im a big fun of yours i like you your amazing waith this site i wanna now about you please m a biggest fun i love too now….

  • 781. invisible123  |  June 29, 2009 at 10: 38 am

    pls reply im begging for you im your BIGGEST FAN pls reply this massage at my the top of this massage pls….

  • 782. invisible123  |  June 29, 2009 at 10: 39 am

    why you never reply me i told ya a cheat for your site saw it?

  • 783. calv  |  June 29, 2009 at 8: 29 pm

    did u EVA- wait..i can’t think of anything :s

  • 784. invisible123  |  June 30, 2009 at 2: 22 am

    frosty i like your website i love it im serching many websites for dizzywood chaets your is cool!!!!!!

  • 785. coola13  |  June 30, 2009 at 7: 55 pm

    wats with the new u cant zap dizzys anymore could u pls check into it

  • 786. frosty♥  |  June 30, 2009 at 7: 58 pm

    i already did.

  • 787. koko56  |  July 1, 2009 at 12: 13 pm

    hey frosty! r u starting to get bored of dizzywood? i am…

  • 788. Celmiea  |  July 1, 2009 at 7: 44 pm

    dear frosty, i think i should quit.There is way too much drama in dizzywood! should i?

  • 789. frosty♥  |  July 1, 2009 at 7: 51 pm

    dramawood always has its problems :] but if you quit its like your running away from it :/ plus if you quit when you really dont want to, which most people do (well they say they quit) you just come back in a few days.
    so do whatever your little dw heart desires

  • 790. kourtnee  |  July 3, 2009 at 8: 56 pm

    where do ya get forth of july things

  • 791. puppypie57  |  July 5, 2009 at 2: 01 pm

    Where`s the baby bears mom and dad?
    where`s the rare pink coconut?
    i cant find them.

  • 792. frosty♥  |  July 5, 2009 at 3: 26 pm

    the baby bears mom and dad are on mount fantage, follow the pawprints into the forest and go left.
    the pink coconut is at the beach hanging on a tree.

  • 793. laila223  |  July 5, 2009 at 5: 59 pm

    hey frosty!can u become boss of the cafe in dw? and can i be your buddy?u even own fantage i have a fantage and if u wanna be my buddy i’ll be at the cafe in canal city!

  • 794. ♀♥~Sweetie~♥♀  |  July 5, 2009 at 8: 11 pm

    She doesn’t own it -.- She’s just like famous :lol: And she’s a beta. Seriously, you think she owns dw or fantage??? PSSH. She’s awesome but not awesome enough to own a game :lol: She’s stiill awesomefull :mrgreen:

  • 795. 5289Girl  |  July 6, 2009 at 1: 44 pm

    wats ur password?

  • 796. frosty♥  |  July 6, 2009 at 2: 05 pm

    n0tt311ingstupid

  • 797. ♀♥~Sweetie~♥♀  |  July 6, 2009 at 4: 16 pm

    Dude, you don’t ask people their password. Seriously -.- Lol nice password ;)

  • 798. frosty♥  |  July 6, 2009 at 4: 19 pm

    people are soo dumb sometimess

  • 799. superA  |  July 6, 2009 at 7: 34 pm

    frosty can i plz plz plz meet u on wobbly in mages barrow plz? i really want to be ur friend

  • 800. koko56  |  July 6, 2009 at 10: 46 pm

    dear frosty, this is probably a quistion that u forgot y sooo ya so heres the quistion how did u come up with the username frosty?
    I know a pointless quistion, but i wonder a lot….

  • 801. laila224  |  July 9, 2009 at 2: 20 am

    frosty can i plz plz plz meet u tomorrow at the crystal cactoboms?

  • 802. dreamer1223  |  July 10, 2009 at 11: 59 am

    hey frosty, ive got dizzywood news. u can c it at my blog.

    ~dream♥ :3

  • 803. pinkcat3  |  July 11, 2009 at 11: 58 am

    hey!frosty!how do u get critters if u are not silver or gold?

  • 804. laila224  |  July 16, 2009 at 11: 43 pm

    this boy on dw says hes presedent on dw his username is pinoycool is he really???
    frosty: hahaa no way is he “president” of dizzywood! he just thinks he is :]

  • 805. laila224  |  July 16, 2009 at 11: 44 pm

    and then this girl is trying to get me out of gilbert square west can she??
    frosty: no…unless she’s magic or something

  • 806. janh  |  July 18, 2009 at 6: 09 pm

    1-plz tell me wats bunnycorns favorite food?
    2-how can i win the second crystal badge?
    collecting crystals at the bottom and top part of jaguar temple does not seem to be helping.

  • 807. frosty♥  |  July 18, 2009 at 6: 10 pm

    1. its the cupcake emote
    2. uhm i dont know? i dont really try to get badges on dizzywood

  • 808. americangirltiffany  |  July 19, 2009 at 1: 49 pm

    HEY!
    DO YOU KNOW CRAZYMAY?
    WELL IF YOU DO AND SHE TOLD YOU HER PASS COULD I HAVE IT?
    PLEEEEEEEEEEEEEEEAAAAAAAAAAASSSSSSEEEEE!
    I WOULD BE SOOOOOOOOOOO HAPPY!
    :)
    :D
    :P
    I HAVENT DONE EMOTION IN A LONG TIME!

  • 809. frosty♥  |  July 19, 2009 at 1: 56 pm

    i do, kinda, and if she did (which she didnt) why would i ever tell you?

  • 810. ydoggy  |  July 19, 2009 at 2: 34 pm

    :p <—– i luv this face it is sticking its tounge out ok here is my question if someone hacked your site who would be your first guess i remember when this happened b4 it was like lemonade or something

  • 811. frosty♥  |  July 19, 2009 at 2: 43 pm

    it wasnt lemonade??
    i know who it was and idk why they hacked me because i barely knew them. besides if some1 hacked me right now it could be anyone w/ no life.

  • 812. knight2009  |  July 20, 2009 at 8: 52 am

    how can i get a critter w/out silver/gold explorer? by the way more some dizzies will knew your website!!!!!

  • 813. no0ody97  |  July 20, 2009 at 6: 22 pm

    thats marvelous

  • 814. xxcastawayxx  |  July 21, 2009 at 11: 41 am

    on fantage, where does a creature go when u buy one??? i just bought one and i cant find it

  • 815. frosty♥  |  July 21, 2009 at 11: 57 am

    you turn into it in the creature arena. go to the creature arena on your map then go right over the bridge and into the portal

  • 816. koko56  |  July 21, 2009 at 12: 18 pm

    i forgot wat servers u mainly go on, on fantage! can u tell me again?

    frosty: i go on like every server but if i can i go on maroon moose or lava gerbil (or servers around there)

  • 817. xxcastawayxx  |  July 21, 2009 at 2: 22 pm

    o thx

  • 818. ydoggy  |  July 21, 2009 at 3: 07 pm

    frosty wats the creature arena even for all u do is walk around

    frosty: sometimes little stars pop up and you collect them for real StarS to buy stuff :] and its just fun

  • 819. kandykorn11  |  July 21, 2009 at 5: 37 pm

    its sooo awesome!
    i have to pets
    a duck and the lil cute dog!

  • 820. kandykorn11  |  July 21, 2009 at 5: 38 pm

    *two pets

  • 821. Me!!!  |  July 21, 2009 at 8: 32 pm

    Okay everyone is walking around with these cool white and pink shirts with a pink balloon where the heck do you get them??

  • 822. frosty♥  |  July 21, 2009 at 8: 36 pm

    its a new rare item you get from wizards domain (3 rare sapphires)

  • 823. koko56  |  July 21, 2009 at 8: 54 pm

    thanks frosty and which website do u go on more for fun?

  • 824. frosty♥  |  July 21, 2009 at 8: 56 pm

    ..fantage right noww. i dont really like the people on dizzywood that much…there not all very nice…

  • 825. ydoggy  |  July 21, 2009 at 10: 32 pm

    u dont have to have 3 rare sapphires then it would be prem members only an i am not one and i have it u can do i sapphire and 2 rubies

  • 826. lollipop123  |  July 22, 2009 at 5: 08 am

    how do you get the board in fantage with the arrows? plz reply

  • 827. lollipop123  |  July 22, 2009 at 5: 10 am

    and how do you get the combed her for boys and plz tell me what gems plz reply

  • 828. lollipop123  |  July 22, 2009 at 5: 10 am

    plz reply and tell me what gems

  • 829. lollipop123  |  July 22, 2009 at 5: 30 am

    you dont have to tell me what gems to get the board cuz i no now

  • 830. lollipop123  |  July 22, 2009 at 5: 31 am

    you dont have to tell me what gems to get the board cuz i no now
    but can you tell me where to get the combed hair plz for guys

  • 831. koko56  |  July 22, 2009 at 12: 20 pm

    omg i agree with u i have some friends who r nice but so much drama!

  • 832. janh  |  July 23, 2009 at 7: 16 pm

    frosty, i know wat u mean about dizzywood ppl being mean. ive dropped many buddies for being mean. then again ive mad some really nice buddies. plz come ba ck to dizzywood. i enjoy ur site so much. besides, who else would i ask all these questions to?
    ur site is the best one!!
    sincerely, janh

  • 833. kicha  |  July 24, 2009 at 6: 25 am

    hi frosty wat time do u normally come on dizzywood

  • 834. kicha  |  July 24, 2009 at 6: 26 am

    how do i create my own site

  • 835. kicha  |  July 24, 2009 at 6: 28 am

    were r most of the move scrolls in dw

  • 836. Kaylaa  |  July 24, 2009 at 2: 33 pm

    How do you get the Crystal icy aiere key?

  • 837. frosty♥  |  July 24, 2009 at 2: 37 pm

    you have to do the mission “Find The Crystal Key To The Icy Aerie” to get it. check your missions tab.

  • 838. kaylaa04  |  July 24, 2009 at 3: 08 pm

    alright thanks frosty!! =)

  • 839. janh  |  July 24, 2009 at 9: 03 pm

    HELP HELP HELP
    i need to know where the last two fish are to get my badge.
    ive fished at tanglewood jungle, wildwood glen, canal city east and west, of course the beach, and even gull island,
    for crine out loud!!!!!

    where else can they be?
    HELP HELP HELP

  • 840. Xx~Dark Angel~xX  |  July 25, 2009 at 12: 03 am

    couldn’t you do a fantage history page thats sort of like the dizzywood one? although i cant find any information on fantage and the time it started :/

  • 841. kaylaa04  |  July 26, 2009 at 2: 29 pm

    hey frosty its me again ! how do you get your pictures to be big when you put them on your post?

  • 842. pringles19  |  July 26, 2009 at 4: 28 pm

    hey frosty!
    how cum now we cant get the kiity critters cuz i want one but all we get is coins.i want a critter but im not silver.

  • 843. fang  |  July 27, 2009 at 6: 53 pm

    frosty of fantage how do i wear old member stuff i was a member now im not

  • 844. frosty♥  |  July 27, 2009 at 6: 54 pm

    you dont.

  • 845. ydoggy  |  July 27, 2009 at 9: 02 pm

    lol frosty of fantage that would be like in jonas that weirs fan girl is like joe of jonas and watev oh wait u meant frosty on

  • 846. xxxluvbunnyxxx  |  July 28, 2009 at 10: 17 am

    Hey Frosty,

    Do u think its unfair that you have to be silver or gold to get all the kol stuff now. I knew they wouldn’t keep evrything free for long!

    frosty: its not unfair…oh and dont use a word in that way when you probably dont even know what it means. k thanks.

  • 847. jzrixcooi  |  July 29, 2009 at 6: 34 am

    Chyo, how much moolah have you got right now and the most ever? I currently gave 83, 000. I have a screenie from yesterday, when I had 2000 less for proof.
    http://img176.imageshack.us/img176/1518/moolaghscxreen.jpg

  • 848. Anonymous  |  July 30, 2009 at 3: 07 pm

    can some 1 un ip ban me? i got banned for glitching i guess… when i was pking i was in room and i was atting him. he thout it was glitching….

  • 849. alyssa murray  |  July 30, 2009 at 5: 23 pm

    hey frosty on fantage do you know where the three red rubies are so i can get the special board from orion plz plz plz help me i really want it!!!!!
    thanks 8)
    frosty: what do you mean where? you get them by playing one of the 4 games at wizards domain…

  • 850. dream  |  July 30, 2009 at 5: 46 pm

    hey frosty!

    tomorrow is the sandbar party! r u going to b there? or r u going some other day becuz the party goes from tomorrow to august 10th!

    and have u noticed the new search wordpress thing at the top of the page when ur logged into wordpress? weird isnt it?

    ~dream♥ :3

    frosty: im actually going on vacation tomorrow for a week but i can probably go on in the morning. and i thought the search thing was always there ._.

  • 851. dream  |  July 30, 2009 at 7: 06 pm

    no, it wasnt, there was nothing in the top right corner.

    ~dream♥ :3

  • 852. account trader  |  July 31, 2009 at 10: 11 pm

    HOW CAN WE GET FREEEEEEEEEEEEEEEEEEEEEEEEEEE MEMBERSHIP ON FANATGE

  • 853. account trader  |  July 31, 2009 at 10: 12 pm

    how can we get free membership on both websites

  • 854. plzzzzzzzzzzzzzz  |  July 31, 2009 at 10: 16 pm

    where is the clown girl for bear cub mission i dont see her at the carnival

  • 855. janh  |  August 1, 2009 at 10: 12 am

    HELP PLZ!
    im doing the mission, SUMMER FLOWERS. plz tell me wheres the hibiscus in the sand? ive looked everywhere.
    hope u had a great vacation, frosty!
    janh

  • 856. janh  |  August 1, 2009 at 10: 52 am

    frosty
    i found it!
    the hibiscus flower in the sand is by the beach hut ,
    behind the clothes sign. use ur ghost ray.
    ha!
    janh

  • 857. fantageguardian  |  August 5, 2009 at 7: 45 pm

    help me its about wordpress i cant upload my pictures it always say ” File type does not meet security guidelines. Try another ” help me plz ! :(

  • 858. Rockstar515  |  August 8, 2009 at 2: 00 am

    Hi Frosty! OMG OMG thx a bunhes for all the help on missions and i totaly love this website.
    Hey, I was just wondering can i be on your blog or pst of watever? But first i want to know, um do you need my pass so I can know? Plz reply! NOTE: dont e-mail me lol nothing personal

  • 859. 1ryan  |  August 8, 2009 at 2: 59 pm

    why would frosty give out personal imfo? :?

  • 860. 1ryan  |  August 8, 2009 at 3: 02 pm

    :upset:

  • 861. 1ryan  |  August 8, 2009 at 3: 04 pm

    :mad:

  • 862. 1ryan  |  August 8, 2009 at 3: 06 pm

    :mrgreen:

  • 863. katharine  |  August 9, 2009 at 12: 18 pm

    how do you get a fish in dizzywood

  • 864. kandyriot  |  August 9, 2009 at 2: 33 pm

    go fishing to get fish. if u catch ten fish, u get the rod and reeler badge.

  • 865. janh  |  August 9, 2009 at 3: 40 pm

    the last comment was me as well

  • 866. shannon :D  |  August 10, 2009 at 11: 06 am

    heh

  • 867. katharine  |  August 10, 2009 at 1: 17 pm

    how do you find the blush berry seed

  • 868. LadySweet911 {dizzywood}  |  August 10, 2009 at 11: 27 pm

    How do you make lots of money on dizzywood?
    What game has the most amount of coins to win?
    Please email me {anyone} i need more friends.
    From LadySweet911 xxx

    email: emily_evans11@hotmail.com
    P.S I have a MSN on same as my email.

  • 869. LadySweet911 {dizzywood}  |  August 10, 2009 at 11: 29 pm

    thanks 863 i need more badges

  • 870. LadySweet911 {dizzywood}  |  August 10, 2009 at 11: 30 pm

    thanks 864 i need more badges

  • 871. flower_petal123  |  August 11, 2009 at 3: 06 am

    EHMAGOD D. the slider puzzle is too hard i cant do it waaaaaa. i dont ever c u on dw. r u america ppl??? .D me goldie yay plz reply girll o btw do u have a email???

  • 872. amelia  |  August 12, 2009 at 1: 45 am

    how do you reset fantage missions

    frosty: contact fantage and ask them to reset it for you

  • 873. logic44  |  August 12, 2009 at 4: 46 am

    hi..uhmm…can i ask how to hack a dizzywood account?please i need to hack my sister’s account…i swear i wont hack your account

    frosty: you seriously think th–. ok well “hacking” in dizzywood terms is finding out other peoples passwords. your sisters? she probably has her account and password save on her computer or written down somewhere. okay nice talking 2 u.

  • 874. Julia  |  August 14, 2009 at 4: 12 pm

    on fantage is your name frosty

    frosty: yes…

  • 875. lollipop123  |  August 14, 2009 at 5: 14 pm

    frosty can you play tell me what gems did you use to get that blue bandana? please write back.:) :) :)

  • 876. xxcastawayxx  |  August 15, 2009 at 4: 04 pm

    what im trying to figure out how to tak pics on fantage, so how do u take pics?

    frosty: press alt and print screen on your keyboard then go to paint then to edit paste

  • 877. kanga_roo  |  August 15, 2009 at 4: 30 pm

    hey frosty…WHY ARE SO MANY PPL ON UR SITE?!?! lol
    how did u kno the color of that kids underwear O.O
    XD

  • 878. xxcastawayxx  |  August 15, 2009 at 7: 33 pm

    kk thx alot!

  • 879. xxcastawayxx  |  August 15, 2009 at 7: 58 pm

    wait….wheres print screen, and if i put print page, it only lets me print it……..i think

    frosty: its a button in the same sort of line as all the F#’s it might say Prt Scr

  • 880. xxcastawayxx  |  August 15, 2009 at 10: 01 pm

    ohhhhhhhhhhh ok

  • 881. xxcastawayxx  |  August 15, 2009 at 10: 11 pm

    i……..i…..i just dont understand………its…….its…….it……just……just wont work…….and…..I DONT KNOW WHY!! :( :( :’(

  • 882. Andrea  |  August 16, 2009 at 4: 15 pm

    on fantage what gem combo do i do to get the red flower shoes (its rare)

    frosty: there is no such thing as the red flower shoes. there is flower sandals, and red heels, but no red flower shoes. and if its rare, then thats your combo. read up above before you ask for gem combinations.

  • 883. canyonroberts  |  August 17, 2009 at 12: 18 am

    forsty i swere your the nicest pirson on earth and how do u get the blue hat boys all ways have on them

  • 884. Anonymous  |  August 17, 2009 at 10: 59 am

    A while ago I went over to the bear cub not knowing what a mission was (it was my first time on fantage) and right away he said, “Have you found my parents yet? I last saw them on the mountain.” So I replied the only choice of, “I’m on it!” So, not knowing what I was doing, I went to the mountain. I walked around trying to figure out what to do when I suddenly saw footprints. I followed them to nothing. When I look at walkthroughs of this mission it shows the cub’s parents in a cage. However I see nothing but the trees and snow. Basically it’s just the mountain. When I walk to the left there are more footprints but they lead me to more trees. When I go to the mission center it always says “In-Progress” or “Paused.” What do I do? Is there a way to restart it?
    frosty: thats exactly what happened to me. if you contact fantage (go to fantage.com then contact us) and tell them whats wrong they will restart it for you.

  • 885. frosty♥  |  August 17, 2009 at 11: 23 am

    uhh thanks canyonroberts but since im not a guy i dont really know how to get the blue hat for boys.
    im thinking of going on my brothers old account though to try to help the guys >.<

  • 886. canyonroberts  |  August 17, 2009 at 12: 08 pm

    ohhhhhhhhhh ok

  • 887. canyonroberts  |  August 17, 2009 at 12: 09 pm

    im on fantage right now please get on

  • 888. frosty♥  |  August 17, 2009 at 12: 11 pm

    im on now…where are you?

  • 889. canyonroberts  |  August 17, 2009 at 12: 11 pm

    the first one press tab and use the arow keys to get the first one if its full

  • 890. canyonroberts  |  August 17, 2009 at 12: 12 pm

    top models

  • 891. canyonroberts  |  August 17, 2009 at 12: 12 pm

    down town

  • 892. frosty♥  |  August 17, 2009 at 12: 14 pm

    ._. thats where i am too

  • 893. canyonroberts  |  August 17, 2009 at 12: 14 pm

    hello

  • 894. canyonroberts  |  August 17, 2009 at 12: 14 pm

    ok top models

  • 895. frosty♥  |  August 17, 2009 at 12: 15 pm

    ok?

  • 896. canyonroberts  |  August 17, 2009 at 12: 19 pm

    frosty

  • 897. canyonroberts  |  August 17, 2009 at 12: 19 pm

    wat server are u on

  • 898. canyonroberts  |  August 17, 2009 at 12: 21 pm

    wat server are u on
    frosty

  • 899. canyonroberts  |  August 17, 2009 at 12: 25 pm

    this is my user name on fantage

  • 900. canyonroberts  |  August 17, 2009 at 12: 27 pm

    hey plz anser me frosty

  • 901. frosty♥  |  August 17, 2009 at 12: 29 pm

    im on amber antelope the first server in top models INC

  • 902. canyonroberts  |  August 17, 2009 at 12: 38 pm

    you rock frosty

  • 903. xxcastawayxx  |  August 17, 2009 at 12: 55 pm

    ok i got the picture thing to work….thx

  • 904. jenn  |  August 17, 2009 at 5: 35 pm

    hey every one i have a new charter on dizzy wood! meet me soon!

  • 905. jenn  |  August 17, 2009 at 5: 39 pm

    hey, sorry aboit the one on top that was actually me. i thought that it would change or somehthing. that was on mistake. anyway, emmie1ihycf3475 is my character in fantage and dizzy wood is juliaheart something something. i don’t like fantage so much. how old are all of you? are you teenagers? ADULTS???? im gonna be a teeneger in two years. never mind. i dont even know why im on this site. i was gonna go on club penguin. never mind about all i said. bye

  • 906. stephanei1803  |  August 18, 2009 at 5: 55 am

    hi frosty!!!
    i admire you!
    i have a few questions i would love fo u to answer! either via this or my email!
    1. which game earns u the most coins the quickest?
    2. are there any cheats you can activate on fantage?
    3. im a premuim member… what is the one item you think all premuim members should own?
    frosty you totally rock!!!!!! hope you reply!!!!! pls pls pls pls!!!
    your biggest fan!
    stephanie1803
    (thats my fantage username)

    frosty: answers:
    1. i usually do fashion shows or games in the forest so i can get gems at the same time. for coins quick and fast i play snack tac toe.
    2. there are some cheats you can do, i was actually going to make a page of that today.
    3. if your a premium member you should get all items ^.^ i really love the new earrings though for girls…and all the sunglasses.

  • 907. canyonroberts  |  August 18, 2009 at 4: 32 pm

    frosty why wont you get on fantage
    send me a message on fantage last time i seen u you were at mt. fantage i been geting on fantage non stop and frosty do u know bella rocker 94 cause shes my sister and y are u never on fantage email me frostyplzzzzzzzz email me no one ever e mails me plzzzz
    if u have my email adress that wod be super cool ohh yah i been working out i mit become premermember try out this web site webkinz my user is kogfo so mail me on fantage or email me im geting a my space to maybe

  • 908. canyonroberts  |  August 18, 2009 at 9: 26 pm

    frosty how do u make this chat thing

  • 909. canyonroberts  |  August 18, 2009 at 9: 52 pm

    try out my new website http://www.askcanyon.yolasite.com

  • 910. stephanie1803  |  August 19, 2009 at 6: 41 am

    thanks frosty for the answers! have you made the page yet?…i was sooo happy that u replied to my questions!!!!!! THANKS!!! i admire u soooooooooooooo much! you were my inspiration to become a premuim member on fantgae! thanks so much for being awesome!!!!!!!!! by the way….what game is the easiest and quickest to earn gems? hope u reply….again!!!

    your BIGGEST!!!!
    fan
    stephanie1803 :)

  • 911. kiikii  |  August 19, 2009 at 10: 03 am

    frosty what server you go always ? i want to know my username is toonii59 to be my budd and … ok ?

  • 912. kiikii  |  August 19, 2009 at 10: 04 am

    please

  • 913. melodey123  |  August 19, 2009 at 1: 13 pm

    frosty, what server do you go on on FANTAGE because im ur buddy if u remember on fantage me ( melodey123 ) what server do u go on i NEVER find you…..

    frosty: usually amber antelope orrrr indigo fox

  • 914. Arctir  |  August 20, 2009 at 6: 26 am

    Do you have any cheats to become a premuim member??

    frosty: there are no cheats for fantage to get premium clothes, free stars, or anything like that.

  • 915. spongebob2010 (Fantage Account)  |  August 20, 2009 at 10: 51 am

    Heyy Frosty i Have A Problem….
    I Accidentally Put My Boyfriend On My Ignore List.
    Now We Can’t Send Each Other Stickers And Stuff.
    How Do I Get Him Off My Ignore List?

    - spongebob2010

    p.s remember me? i’m also readhead234 on dizzywood

    frosty: ._. uhm…you go to your buddy list then click the tab “ignore list” thats next to the tab “buddy list” …

  • 916. ydoggy  |  August 20, 2009 at 2: 32 pm

    Can u have B.O.T.W Blog of the week everyone votes on their fave blog whoever wins get a prize and gosh when will u have a party lady do it be for the 24 thats when my stupid new school start uh

  • 917. stephanie1803  |  August 21, 2009 at 12: 11 am

    FROSTY !!!! PLS REPLY TO MY QUESTION ABOVE! U ANSWERED EVEY QUESTION EXCEPT MINE!!! WHY??>? PLS RELPY!
    !!!!
    I STILL LOVE U!
    <3
    STEPHNAIE1803

  • 918. Anonymous  |  August 21, 2009 at 3: 23 pm

    Hiya , Frosty. I love your page, its adorable. :]
    Anyways, I was wondering how to get rare stuff from orion {The Wizard Guy} for nonmembers. Like that cape, the wand, and the hat. Everytime I ask someone they don’t tell.

    frosty: the wand wizard & cape were from the wizard party. you can no longer get them since they were only there during that time sorry. & thanks

  • 919. Anonymous  |  August 21, 2009 at 3: 59 pm

    what is a comet contest?
    frosty: on fantage theirs a magazine sort of thing call the comet. there are contests and things in it that you can enter and do. here is the link to the newest issue: http://play.fantage.com/newspaper1.html enjoy :3

  • 920. fluffy bunny  |  August 22, 2009 at 1: 43 am

    hey frosty!! i love your site sooo much!! its helped me soo much on fantage! now i can go on the same server as my friends even if they are full! your cheats have been so useful! not only coz they actually work but also coz there really good!
    i have some questions
    1. when are fantage going to make new missions
    2. on ur idfone it says ur level, how do u get ur level higher?
    3. like club penguin, are there any secret areas or any places only for premuim members?

    pls reply frosty!!
    fluffy bunny

    frosty: answers-
    1. uhm since i do not work for fantage i have no idea.
    2. click- http://frosty1297.wordpress.com/medals-levels/
    3. no not yet but im pretty sure for the upcoming dance party there will be a members only room.

  • 921. canyonroberts  |  August 22, 2009 at 10: 32 am

    frosty u there

  • 922. canyonroberts  |  August 22, 2009 at 10: 33 am

    frosty u there hello

  • 923. lilspoileddiva  |  August 22, 2009 at 1: 29 pm

    hey frosty!!
    how do i get the puffy blue shirt? i tried all ur combonations and it didnt work

    frosty: its a rare item but if ur a non member and got all the items you could then you cant get it. if your a member its a rare item. http://frosty1297.wordpress.com/gems-items/

  • 924. lilspoileddiva  |  August 22, 2009 at 3: 39 pm

    ok thx!! i luv ur cheats!

  • 925. kittykatt55  |  August 22, 2009 at 11: 50 pm

    Hey You Better Answer this! is orange ur fav color?
    frosty: why yes, yes it is

  • 926. canyonroberts  |  August 23, 2009 at 5: 17 pm

    yo frosty wat up

  • 927. evypara2  |  August 24, 2009 at 5: 30 pm

    hello frosty!!
    i just wanted to ask u where r ur cheats?
    but i still really like ur site anyway lets hang!

  • 928. Anonymous  |  August 24, 2009 at 7: 08 pm

    1. Can you give people stars?

    2. If yes, how?

    3. If yes, do they have to be your friend?

    frosty:
    1. no
    2. see above
    3. see above

  • 929. Read2do (from dizzywood and fantage)  |  August 25, 2009 at 6: 01 am

    hey guys i will give you cheats way better than frostys one and here it is:
    try the code in build a bear for a furry friend….96772187 and the animal ID code: 736251515

  • 930. roxi36  |  August 25, 2009 at 12: 29 pm

    :$ :D :D D :( ;( :O :( ( lol look!

  • 931. kanga_roo  |  August 25, 2009 at 12: 40 pm

    frosty i got bored. what do i do? lol

  • 932. kanga_roo  |  August 25, 2009 at 12: 45 pm

    P.S. I just made a dizzywood. i kno why u quit now. its freaking me out 0.o

  • 933. canyonroberts  |  August 25, 2009 at 5: 21 pm

    frosty where are u

  • 934. rebecca  |  August 25, 2009 at 11: 21 pm

    frosty i have a new idea for your blog conatact me somehow………?

  • 935. Anonymous  |  August 26, 2009 at 12: 29 pm

    this is the new idea
    SEcond-hand-fantage accounts or second hand dizzywood accounts.

  • 936. icarly33  |  August 26, 2009 at 11: 59 pm

    hey um who created fantage?

  • 937. Anonymous  |  August 27, 2009 at 12: 51 am

    What is a fun thing to do on the computer other than fantage?

    p.s. I don’t really find fantage that “fun” I only go on it when I’m bored.

  • 938. frosty  |  August 27, 2009 at 3: 18 pm

    I see….i only go on it when i have no where to go

  • 939. canyonroberts  |  August 27, 2009 at 4: 34 pm

    frosty
    plz get on fantage ill stay on plz

  • 940. canyonroberts  |  August 27, 2009 at 4: 35 pm

    frosty
    plz get on fantage ill stay on plz plz plz plzzzzzzzzzzzzzzzzz

  • 941. tia08  |  August 27, 2009 at 8: 08 pm

    how do u send designs of clothes and other stuff 2 fantage.com?

  • 942. frostys biggest fan!!!!!!  |  August 27, 2009 at 11: 35 pm

    hi frosty i need to se you sometime reall soon.ok or im giving up on my idea ugh ti was a really good one i understand abount school and stuff just talk to me soon ok?

  • 943. shimmerfab  |  August 28, 2009 at 9: 46 am

    hey frosty!~ im shimmerfab:) well do you ever get tired of answering all of these questions? i mean its craaaazy!!lmmfaoo

  • 944. AK  |  August 29, 2009 at 3: 02 pm

    HI

  • 945. francis1237  |  August 30, 2009 at 10: 23 am

    Where can you get the blue bandana?

  • 946. Itachi11  |  August 30, 2009 at 3: 55 pm

    Is the strawberry costume for members only, to prove to my sister that it is.

    And can you give my a list of non members rare items?

    Please and thank you!

  • 947. miss chynia  |  August 30, 2009 at 3: 57 pm

    okay…well this might be a liitle bit weird of a question buttttt……what do you do when u get somebodeh mean on ur blog and they make nasty comments to you?
    just wondering….;)
    pls write back

    hugs,
    misschynia

    frosty: laugh. & figure out who it is. its really not that hard. same with people who pose to be other people on here. seriously i just got 2 comments today saying they were from me. uh duh person, how dumb can you really get?

  • 948. coolgirlie  |  August 30, 2009 at 5: 50 pm

    hi frosty im new and i was wondering that if you can help me with something i need a hat but i cant find it and i thougfht it was a rare item vbut i tried all the combinations but it wont work help e it looks like hat with like a windmill its orange

    frosty: uhm like the april fools hat?

  • 949. fantage411  |  August 30, 2009 at 7: 41 pm

    How did you become famous? I really want to become famous, but it’s really hard. I have made a blog and no one veiws it. How do you make your site become known?

  • 950. Claudia1644  |  August 31, 2009 at 1: 31 pm

    hey frosty plz answer this im a premium member where do u get the crowns? plz write back thx!!!!!!!!!!!!!!!!!!11

  • 951. goodgirl2001  |  August 31, 2009 at 1: 49 pm

    How do get the crowns for the dance party?

  • 952. Anonymous  |  August 31, 2009 at 1: 49 pm

    where do you get the crowns!

  • 953. frosty♥  |  August 31, 2009 at 1: 53 pm

    they. are. not. out. yet.

  • 954. Megrocks123  |  September 2, 2009 at 9: 41 am

    Im kinda new to fantage.If u could e-mail me about Fantage that would be great! Fantage is really a great site!

  • 955. melodey123  |  September 5, 2009 at 3: 08 am

    Hi frosty,

    ummmmmm i think i no the answer to this but since u quit dizzywood………………can i have ur account?????

    frosty: i’ll tell you what i tell every single person who asks me this every day, NO. its mine, i dont want other people using it with all the things and coins ive worked for! and who knows, in another month i might love dizzywood again and i’ll need my account to go on it. i will never EVER give my account to anyone so people should really stop asking.

  • 956. 12345678910meg  |  September 5, 2009 at 10: 49 am

    did u make ur page on wordpress? I want to make a site

  • 957. isf  |  September 5, 2009 at 8: 55 pm

    can u help mew with the new dw mission register for terra

    frosty: this is not a dizzywood site but the new mission is extremely easy i dont really think you need any help. the 3 people you need to see are movemaster swingtail, chanjo, and kat da claw though.

  • 958. hey_you123  |  September 6, 2009 at 1: 28 am

    hey frosty it’s me hey_you123

  • 959. melodey123  |  September 6, 2009 at 5: 00 am

    sry frosty :(

  • 960. frostylala  |  September 6, 2009 at 9: 50 pm

    if this is not a dizzywood site anymore give us your account

    frosty: no way, not now, not ever.

  • 961. Tara103  |  September 8, 2009 at 9: 38 pm

    hi how do you know these stuff?

    frosty: i know all.

  • 962. doglover652  |  September 8, 2009 at 10: 37 pm

    wat r all the anwseres for the pathfinder test?!?!?!?!??!?!?!??!?!??!?!?!?!?!

  • 963. Tara103  |  September 10, 2009 at 8: 41 pm

    WOW I LOVE YOU FOR MAKING THIS SITE! p.s can you tell me how to have more than200 friends

    write back

    from tara103

  • 964. Tara103  |  September 10, 2009 at 8: 46 pm

    frosty I would love to be your friend so if you can can you come to amber antelope at 3;00 clock on the 13th

  • 965. zidriukas  |  September 11, 2009 at 6: 30 pm

    hey frosty, you might remember me from dizzywood. im your friend and buddy.

    i wanna ask u a question about fantage.
    how do i go to level 1 because im to stupid to know how to ???

    plzz answer.

    also if u see me my user is: rasha01 but im not a member.

    my server will be maroon moose.

    bye bye, i hope i meet u.

    i no i wrote too many things…….

    also i quit playing dizzywood……sorry

    (cry’s)

    by zidriukas

    frosty: answer to ur question: check my medals & levels page plzz

  • 966. zidriukas  |  September 11, 2009 at 6: 33 pm

    also my real name is rasha . i know its a dumb name because im an arab.

  • 967. maplewood425  |  September 11, 2009 at 9: 23 pm

    Frosty, that frostylala she did that on a lot of sites so be careful she might change her name too so b careful and make sure no one takes your account!

  • 968. canyonroberts  |  September 12, 2009 at 10: 53 am

    ha this is my real name but a space btwin canyon roberts

  • 969. emilorjames  |  September 12, 2009 at 12: 26 pm

    hi frosty wuts your age?

    frosty: uhm 13?

  • 970. Linda  |  September 12, 2009 at 1: 56 pm

    hey frosty how can there be a “fake fantage”? cuz i was checking out the glitches page and there was a cheat there on how to have no board (btw it didnt work)

    frosty: its a rip off fantage and i know it doesnt work it was fixed like a week ago.

  • 971. maplewood425  |  September 12, 2009 at 2: 09 pm

    cool im ten almost eleven

  • 972. Anonymous  |  September 12, 2009 at 11: 19 pm

    i cant finish mission:missing bear cub & where is the pirate?

  • 973. smileypup11  |  September 12, 2009 at 11: 22 pm

    i can’t finish Mission:The Missing Bear Cub.Where is the Piarite

    frosty: check missions page.

  • 974. (fantage)meandangelcullen  |  September 13, 2009 at 9: 16 am

    Hey frosty i go on everyday what is the new item and where is it

  • 975. Tara103  |  September 15, 2009 at 11: 34 pm

    hi Frosty what is beta and beta testing?

    frosty: a beta is a person that tests something when it firsts comes out to see if it will work. beta testing is that period of time. so, if you played fantage the first few months it came out you’d be considered a beta tester because its basically like your “testing” the game to see if it will become something lots of people will play in the long run. after that period of time usually the company (fantage) puts out ads then so more and more people will come to it.

  • 976. animalcrossingwi  |  September 16, 2009 at 10: 42 am

    hey ummm… frosty i saw a guy witha think asilver board and someone else with a piano board and the silver one had a dog on it its wierd.. can you tell me where toget it or is it in the board shop duh

  • 977. animalcrossingwi  |  September 16, 2009 at 10: 45 am

    Ok nvm also the are new earings dress , stuff like that in the shop

  • 978. Tara103  |  September 17, 2009 at 12: 17 am

    ok thanks FROSTY

  • 979. APerson  |  September 18, 2009 at 7: 50 pm

    “hi Frosty what is beta and beta testing?

    frosty: a beta is a person that tests something when it firsts comes out to see if it will work. beta testing is that period of time. so, if you played fantage the first few months it came out you’d be considered a beta tester because its basically like your “testing” the game to see if it will become something lots of people will play in the long run. after that period of time usually the company (fantage) puts out ads then so more and more people will come to it.”

    You have bad grammar (no offense). I could hardly read that paragraph! Also, you made another mistake. ;) Beta testing is a short period of time in which the site was first made to test out any glitches or bugs. Usually the sites give out special, rare beta items to those that helped test it.

    Heh, sorry about that, Frosty. I just love to correct…its so you can learn, right?

    frosty: you do know i dont have all the time in the world to go back and correct? it saves time to write the way i do. and its not ym fault if you cant read it, i have to answer this question 10 times a day and it gets pretty tiring. and i basically said that it was a short period of time to test the game.

  • 980. APerson  |  September 19, 2009 at 10: 11 am

    Woah, woah. Calm down there! I’m just correcting you, not starting a fight!
    Or are you one of those people who can’t take criticism?

    And…it takes about 3 seconds to capitalize and add punctuation. Most blog writers have that, so people can understand what their writing about.

    frosty: -_-’ i didnt mean to “start a fight” i was just in a bad mood yesterday. anyways, im not like most blog writers. and ive been talking like this online for over 2 years. i capitalize when i feel like it, same with punctuation except for apostrophes because they bug me. i shouldnt have to explain myself on the way i write :/ its not like i misspell words or leave out letters, you can still know what im talking about. besides….i think capitalized letters are kind of ugly. but when im writing in real life or doing things for school its not like i talk the way i talk on my blog. and if lots of people complain about the way i write (which they dont) i will change it to make it easier for them. no worrrrriessss =P

  • 981. toprocker  |  September 19, 2009 at 6: 41 pm

    how do i make a blog like this it is so complicated plz message me
    oh add me im popular my name is toprocker_101 on fantage

  • 982. kevin hgyt  |  September 19, 2009 at 10: 13 pm

    how do you get coins fast

  • 983. APerson  |  September 20, 2009 at 2: 23 pm

    Mmm. okay. ;)

    Uhm, yeah. Good luck with your blog. It’s one of the only blogs about fantage that updates pretty much everyday, and it’s quite useful.
    Thanks and bye.

  • 984. animalcrossingwi  |  September 20, 2009 at 2: 42 pm

    play bobo fish or judge fashion shows

  • 985. miss chynia  |  September 23, 2009 at 5: 03 pm

    Well, i’m not trying to be
    mean or anything, but i think this Aperson guy should be quiet and mind his own beeswax.
    heehee, did u notice that he forgot to punctuate “it’s” while ranting about punctuation? oh and his grammar isn’t very good either. ;)

    frosty is right, sometimes it’s just too hard to capatalize and punctuate.

    and she’s one of the smartest people I knoww….
    xP lmao

  • 986. Tara103  |  September 23, 2009 at 7: 36 pm

    where do you cash your nuggets?

    frosty: once you get all 15 your done and the coins are instantly given to you. check your IDfone

  • 987. SELENA  |  September 23, 2009 at 8: 08 pm

    im cc57 and i usawally go toindago fox

  • 988. jane  |  September 23, 2009 at 11: 43 pm

    heeyyy! my name is jane(: and im just writing to say i luv ur website(X btw i am also an 8th grader only im in california!!! cool huh?

    well keep up the good work~!

  • 989. Anonymous  |  September 24, 2009 at 5: 13 pm

    Hi Frosty,
    On my ID phone right now it would let me show only 9 stickers on a page. The rest is in my inventory but I would like to be able to have more on my ID phone page. Thank you if you can help me.

    frosty: if your a non-member you cant have over 10 stickers on the page (there probably is 10). if someone gives you an eleventh one disappears.

  • 990. kayla  |  September 25, 2009 at 7: 05 pm

    how do you defeat betty the clown on fantage?

  • 991. Joey  |  September 25, 2009 at 10: 02 pm

    how do u get to be a free member?

    frosty: you dont.

  • 992. kristina  |  September 26, 2009 at 1: 02 pm

    what an amazeing website how did u make it and im kinnda stuck on mission 2 can u help me??????? <3

    frosty: check fantage missions page for help pleasee. if you still need help comment on what and ill try to help :]

  • 993. cakiemadie!!  |  September 26, 2009 at 1: 53 pm

    frosty have u ever kissed someone???

    u dont have to tell

    this is a joke!!!!

    har har??

    frosty: alrighty then…

  • 994. irule4357  |  September 26, 2009 at 3: 20 pm

    do you ever get tired of reading these commets

  • 995. tia08  |  September 26, 2009 at 5: 52 pm

    can u help me where 2 find golden nuggets?

  • 996. frosty♥  |  September 26, 2009 at 5: 53 pm

    http://frosty1297.wordpress.com/2009/09/23/thy-gold-rush/

  • 997. dp810  |  September 26, 2009 at 6: 19 pm

    how do u take off ur board

  • 998. frosty♥  |  September 26, 2009 at 6: 22 pm

    u cant anymore

  • 999. kg410  |  September 26, 2009 at 6: 25 pm

    wat level to stop on to get a green gem

  • 1000. Snowdrop100  |  September 27, 2009 at 11: 32 am

    wheres the rock world
    plz hlp me

  • 1001. Nikki  |  September 27, 2009 at 4: 56 pm

    Hey i have a question of course how do you make a site?
    Can you be my buddie my user name EmmaCool123 i always hangout in Blue Tiger.
    Are you in HollyWood right now lol?
    I LIKE PIE DO YOU LIKE PIE? HEY WHAT SCHOOL DO YOU GO TO IM STILL IN MEDLE SCHOOL i hate school proms when your in college will your site still exits?
    THATS ALL THE QUESTTIONs! do you know pandanda

  • 1002. Bee9  |  September 27, 2009 at 5: 45 pm

    how do you get on fake fantage?

  • 1003. bsk012  |  September 27, 2009 at 6: 43 pm

    can you go to the light house becouse some people say you can?

    frosty: its for mission 5

  • 1004. Anonymous  |  September 27, 2009 at 7: 54 pm

    frosty where the gold nuggets are in fantage plz do today its the last day

  • 1005. fantagehappy  |  September 27, 2009 at 11: 01 pm

    How do you get, like, your site to be up on google? Yours is on the top of the page everytime i type in fantage help other than youtube videos. Please and thank u.
    -zehrab (by the way i just made an account today)

    frosty: er i dont know. ask the google people >.<

  • 1006. mmmmonkey  |  September 28, 2009 at 6: 54 pm

    frosty someone stolle my idea in fantage wat should i do

    frosty: er, what idea?

  • 1007. Sarah  |  September 28, 2009 at 8: 21 pm

    Frosty what does the v.i.p. room in top models on fantage loook like plz reply sarah

  • 1008. Strawberryday  |  September 28, 2009 at 8: 29 pm

    Hey Frosty, I once met with you on Amber Antelope but I could never see your words. Sorry. I love your website and go on everyday. Your website it awesome! Can you please tell me what: ‘Beta’ means! I have no idea!

  • 1009. Strawberryday  |  September 28, 2009 at 8: 33 pm

    And i forgot to ask you, in the comp’ ur holding how do i send pics of fantage to you?

  • 1010. Rainas_bff  |  September 28, 2009 at 10: 39 pm

    frosty what sever r u on when u go on fantage? cuz i want to be ur buddy

  • 1011. Rainas_bff  |  September 28, 2009 at 10: 47 pm

    u helped me soo much with the nuggets

  • 1012. motomaddy  |  September 29, 2009 at 3: 39 pm

    Hi Frosty!!!
    What server do u go on on fantage?! (its motomaddy if you remeber me) my name on fantage is
    motomaddy199. check out my site!!
    MOTOMADDY

  • 1013. Strawberryday  |  September 29, 2009 at 3: 49 pm

    If i wanted to make a site on wordpress is it free?

  • 1014. Elle117  |  September 30, 2009 at 12: 41 am

    can you be naked in fantage or wear underwear? lol :)

    frosty: er thatd be a bit inappropriate

  • 1015. Elle117  |  September 30, 2009 at 12: 43 am

    how do you have no board? THIS YEAR 2009

  • 1016. Annoymous  |  October 1, 2009 at 3: 43 am

    Hey, do you know all the Orion non-member items? Can you list them all? Or the ones you have?

  • 1017. sara  |  October 2, 2009 at 3: 08 am

    i no frostys dizzywood account its
    user:frostylala
    pass:dizzywood

  • 1018. sara  |  October 2, 2009 at 3: 11 am

    hehe i wonder wat shes gonna do when i hacked her

    moo ha ha ha

    frosty: everyone knows that, tons of different people go on her.

  • 1019. monique  |  October 2, 2009 at 7: 20 am

    i love this site u help me through so much bye

  • 1020. Anonymous  |  October 2, 2009 at 7: 26 am

    what is the fastest way to get lotss of money plz tell me.

    XD

  • 1021. ace495  |  October 2, 2009 at 9: 54 pm

    hey frosty
    r u the founder of fantage?
    cause my x-friend say u r the first person to go on fantage

    frosty: ._. i always get this question…every single game…
    im not the founder of any games, im only thirteen!! but yeah im beta’s on a lot of games and one of the first people to go on but i didnt make fantage xP

  • 1022. ace495  |  October 2, 2009 at 9: 57 pm

    oh and
    r u buddys with sunami on fantage

    frosty: err no

  • 1023. Iluvmypuppy  |  October 2, 2009 at 10: 17 pm

    Hey Frosty thanks so much for helping us with these troubles on these games. I’m a big fan. I don’t mean to be rude but or you a boy or girl?

    frosty: …. G I R L

  • 1024. kat98  |  October 2, 2009 at 10: 31 pm

    hey! whats up frosty?

  • 1025. kat98  |  October 2, 2009 at 10: 34 pm

    : P

  • 1026. jobro17  |  October 3, 2009 at 9: 30 am

    how do u walk on walls

    frosty: check glitches page.

  • 1027. kat98  |  October 3, 2009 at 1: 42 pm

    why is there an echoing sound when u type into the chat?

  • 1028. frosty♥  |  October 3, 2009 at 1: 42 pm

    ..how should i know?

  • 1029. ydoggy  |  October 3, 2009 at 2: 45 pm

    wat is the grotto for all u do is play magic pop in it

  • 1030. Rainbow292  |  October 3, 2009 at 6: 45 pm

    Hey, do you need a new banner for your site? I could make one for you.

    ~Rainbow292

  • 1031. Cupcake38333  |  October 4, 2009 at 8: 36 am

    Hey frosty do you have a youtube channel well anyway if you do tell me cuz i go on youtube everydaay and umm if your thirteen then wow cuz i am fifteen turning sixteen in november 21 soo i am on my little sisters fantage so if your were wondering her name on her name on fantage is cupcake38333 ok

  • 1032. CupCake38333  |  October 4, 2009 at 8: 41 am

    Hey frosty umm its me and my little sis i am sixteen and my sister is eight she keep wondering how to get more stars on fantage ok Thx so much plz anser me back she only has like 21 coins or stars i mean ok thx bye

  • 1033. lakerlakurai  |  October 4, 2009 at 7: 39 pm

    hey frosty
    luv ur web
    but on halloween
    if u collect the pumpkins do u get free coustumes
    i saw a video and that happened?
    will it work?

    frosty: uhm. thats from last halloween? you really should wait until this one to decide if things will work or not…

  • 1034. Harjot  |  October 5, 2009 at 4: 46 pm

    how do you get to be a free premium member on fantage and what was the prize on the game snowy day and what is on the second floor of the fashion show area

    frosty: 1. you dont 2. there isnt usually a prize but this weekend if you got over 8000 points you got an ultra rare snowday sticker and 3. its a VIP room for members, nothing special.

  • 1035. monique  |  October 6, 2009 at 12: 15 am

    frosty can u meet me on fantage and are u in america or australia

    frosty: sometime, sure. and america.

  • 1036. miss chynia  |  October 6, 2009 at 4: 07 pm

    um frosty, i have a question.

    let’s say you were a memeber, and then you became a non member. how many levels will be taken away from you? i know this is random but i really want to know

    frosty: maybe none or maybe all you earned thats on teh premium member,

  • 1037. monique  |  October 6, 2009 at 5: 12 pm

    can u play tommorrw frost amber antolope
    plz and im austrailian so its hard to figure out the time but i know

    frosty: if u catch me on my meebo to the rightttt i can almost always meet you.

  • 1038. monique  |  October 6, 2009 at 5: 55 pm

    frosty u r so cool\

  • 1039. zoomster8  |  October 6, 2009 at 11: 36 pm

    why do you have to be a member to get all the cool stuff

    frosty: well that an opinion but fantage wants as many members as possible so of course if we pay and are members we get better privileges

  • 1040. monique  |  October 7, 2009 at 5: 53 pm

    err frosty how do u gat in the lighthouse from minime1130

  • 1041. monique  |  October 7, 2009 at 5: 54 pm

    err how do u gat in the lighthouse

    frosty: click http://frosty1297.wordpress.com/2009/10/07/lighthouse/

  • 1042. zoomster8  |  October 7, 2009 at 7: 46 pm

    why

  • 1043. fiona21  |  October 7, 2009 at 9: 46 pm

    hello frosty
    hope you are having a fantastic time
    how are you
    you have a great website

  • 1044. monique  |  October 7, 2009 at 11: 47 pm

    yeah why should we pay to get better stuff

    frosty: why shouldnt you? in real life too we have to pay money to get better things, tis the way things are. its nott hat hard to figure out WHY fantage would need money from peopel and WHY they make it so memebrs get better things. THINK.

  • 1045. monique  |  October 8, 2009 at 2: 05 am

    WHAT IS A COMBO DROP

    frosty: its a game from dw…

  • 1046. egg_tart  |  October 8, 2009 at 9: 58 pm

    Hey Frosty!!When can we meet on Fantage??

  • 1047. minime1130  |  October 9, 2009 at 7: 04 pm

    1.egg tart find her on meebo on the front page of the website and2. whats a dw

    frosty: dw is an online game i used to play. its actually called dizzywood.

  • 1048. piink  |  October 9, 2009 at 8: 36 pm

    hi its piink here why are you not playing dizzywood anymore??

    frosty: because it…sucks

  • 1049. zoomster8  |  October 9, 2009 at 10: 02 pm

    how do you get to meebo

  • 1050. lakerlakurai  |  October 9, 2009 at 11: 30 pm

    do u work with fantage?
    Wat enthecity or u like asian and stuff?

    frosty: uh no i dont work for fantage im only 13. and im german/polish/irish and a lot of other stuff :/

  • 1051. piink  |  October 10, 2009 at 8: 02 am

    why does it suck? what will happen to your membership??

    frosty: since i doubt your even piink, it just does. and my membership ran out awhile ago. (and no, i will not give you my account)

  • 1052. Ruby213  |  October 10, 2009 at 8: 59 am

    Frosty,

    How Long have you played Fantage?
    Don’t you ever get bored?
    How Do you know so much about Fantage?????

    frosty: ive played 19 months but i think i really only went on 5 or 6 of those months. and of course i get bored :/ i dont really know that much about fantage but what i do know and find out i put on here.

  • 1053. Joy202  |  October 10, 2009 at 1: 20 pm

    FROSTY CAN I MEET U NOW ON AMBER ANTELOPE THE LIGHTHOUSE PLZ
    I’VE ALWAYS WANTED TO MEET U
    PLZ PLZ PLZ

    frosty:…sure.

  • 1054. Joy202  |  October 10, 2009 at 1: 35 pm

    THANK U SOO MUCH FROSTY!!!
    UR THE BEST!!

  • 1055. zoomster8  |  October 10, 2009 at 5: 11 pm

    when are u on

    frosty: uh i dont really have a specific time where i go on.

  • 1056. piink  |  October 10, 2009 at 7: 25 pm

    im not asking for your account and yes im not really piink i just like you very much im a fan thats why

  • 1057. zoomster8  |  October 10, 2009 at 11: 52 pm

    well morning noon or night

  • 1058. i_am_azn  |  October 11, 2009 at 10: 46 am

    Omg that is a lot of questions

  • 1059. Angie  |  October 11, 2009 at 1: 11 pm

    How can i delete teh creatures i bought at the store????

    frosty: you cant?

  • 1060. lakerlakurai  |  October 11, 2009 at 10: 54 pm

    thx for answering
    my friend made her account on fantage frostyemily
    she loves ur site

  • 1061. SELENA  |  October 12, 2009 at 12: 30 pm

    HOW DID YOU MAKE UR OWN WEBSITE I WANT TO MAKE ONE BUT I DONT KNOW HOW. PLEASE CONTACT ME AS SOON AS POSSIBLE .BYE

  • 1062. lala  |  October 12, 2009 at 1: 46 pm

    frosty, i think i saw you on the server wobbly, im not sure.
    i have a great deal with u, if u want too. can i be one of ur workers, and i will give you 15 stickers. and maybe ten rare.
    if anyone else wants this instead of frosty, well then answer this question and i will see if it is right.
    were do i usually like to be?
    a. my home
    b. star cafe
    c. le shop
    d. none above
    if u see me on fantage, my name is lilly4004! hope to see u!
    im usually playing on mon-sat, 10:00am – 8:00pm. as u can see, i dont play on sunday because i go church and i have to go
    see u out there!!
    xx

    frosty: you didnt see me, im not frostylala. and i dont need any workers, sorry.

  • 1063. Tara103  |  October 12, 2009 at 5: 13 pm

    how do you go in the lighthouse????

  • 1064. frosty♥  |  October 12, 2009 at 5: 27 pm

    you cant….yet ?

  • 1065. canyonrobets  |  October 13, 2009 at 12: 52 pm

    hey yo yo frosty

  • 1066. Crelcel  |  October 13, 2009 at 4: 48 pm

    Frosty, i accidentally ignored my bestest buddy on fantage and now i cant see what hes saying!! plz help. i hope i can un-ignore him. thnx!!
    ~Crelcel

    frosty: open your buddylist and at the top(ish) part of the box theres a little tab that says “Buddy List” then “Ignore List”. go to your ignore list then click your friends name. then click remove, and they’re not ignored anymore (you may have to re-buddy them though)

  • 1067. Snowangel61  |  October 13, 2009 at 5: 53 pm

    Hiiii fantagestic site!

  • 1068. Ruby213  |  October 14, 2009 at 5: 06 am

    I heard there is a halloween party on 26th of Oct til first of Nov.
    Frosty are you going to attend it?
    When do we get the costumes??

  • 1069. tricia  |  October 14, 2009 at 8: 19 am

    hi frosty, how do i become a member for free?please answer me.

  • 1070. tricia_93  |  October 14, 2009 at 8: 24 am

    hey frosty , im new here just wondering:
    how can i become a member for free in fantage . please answer me plaese.

    frosty: you cant.

  • 1071. twilight4eva79  |  October 14, 2009 at 6: 58 pm

    how come when i did the whole gems thing i didnt get a red high heels or a blue hair with a hat?? =(

  • 1072. Angie  |  October 14, 2009 at 7: 16 pm

    Hey Frosty,
    At the wizards domain can nonmembers very rare items, and/or ultra rare items?
    P.S. I KNOW ONLY MEMBERS CAN GET LEGENDARY ITEMS

    frosty: go to the gems->items page and read the frequently asked questions.

  • 1073. SkyLight55  |  October 14, 2009 at 9: 49 pm

    Uhmm hi frosty i need a little help on how to get about 600 stars
    ( like a cheat not just play game) :}

    frosty: if you play splash power up about 4 times you can get 600 stars. (if your real good)

  • 1074. Tara103  |  October 14, 2009 at 11: 36 pm

    ok

  • 1075. Tara103  |  October 14, 2009 at 11: 38 pm

    frosty I didn’t get any red high heels or some other stuff whats wrong with it?

  • 1076. Frenchy64998  |  October 15, 2009 at 1: 52 am

    hi frosty
    wow u seem REALY popular

  • 1077. Frenchy64998  |  October 15, 2009 at 1: 54 am

    hi frosty again

    u seem realy popular
    how do u get ONLY underwear on
    on fantage?

    frosty: it was a glitch but now only hackers do it (by hacking), and if you hack you’ll probably not only get banned but well hackings not really…legal.

  • 1078. Frenchy64998  |  October 15, 2009 at 2: 00 am

    o and
    i dont know wat happend to my computer
    since ive been going on fantage my computer always frezez

    frosty: games always have glitches, and i freeze sometimes too but u might hav a virus too so u might want 2 check on that….

  • 1079. sadj  |  October 15, 2009 at 5: 27 pm

    i hate school evything about expext friends nice caring friends

  • 1080. pinbug101  |  October 15, 2009 at 7: 02 pm

    HI FROSTY WELL YOU SEE I WANT TO GET A FANTAGE MONEY MAKER BUT I CANT AND HOW DO YOU GET NO BORED PLZ TELL ME YOUR GOOD FRIEND PINBUG101 =>

    frosty: there is no “money maker” or way you can get free coins, nor can you get no baord without hacking anymore. same goes with free membership, not possible.

  • 1081. Hafsah Mirza  |  October 15, 2009 at 10: 01 pm

    in one of those quests, how can u get to the lighthouse? i have a feeling that u need a key. please just….(sigh) ………i’m begging u!!!!!!!!!!!!!!!!!!!!!!!!!!!!

    frosty: check the missions page, you dont need a key. all you have to do is click a sign. and otherwise if your not doing the mission you cannot go into the lighthouse.

  • 1082. boubey  |  October 16, 2009 at 9: 12 am

    can you please tell me a member code because i m from an ather country and ican be a member

    frosty: there is no member code or free membership and even if your from another country you just use credit cards or send the money in i think….and anyone can do that.

  • 1083. Smilethemile (FantageIsCool)  |  October 16, 2009 at 7: 31 pm

    hi is this thing about dizzywood only???

  • 1084. pinbug101  |  October 16, 2009 at 8: 04 pm

    HI FROSTY ITS PINBUG101 AGAIN I WAS WONDERING HOW TO GET THE MOST STARS ON FANATGE BECAUSE I DONT HAVE ALOT OF MONEY PLZ HELP ME YOUR GOOD FRIEND PINBUG101 =>

  • 1085. zoomster8  |  October 17, 2009 at 11: 49 am

    what r some cheats that u can do for holloween

  • 1086. Joy202  |  October 17, 2009 at 1: 24 pm

    frosty
    how do u get the mummy costume?

    frosty: you cant :/ i dont know if it’ll be back this year either.

  • 1087. Joy202  |  October 17, 2009 at 8: 30 pm

    uhh…
    frosty wat place r u usually in? (downtown, castle,grotto etc.)

    frosty: usually im downtown or uptown ^^

  • 1088. aly  |  October 17, 2009 at 10: 54 pm

    i need your help on how to win the polor bear cub thing on fantage

  • 1089. alex1773  |  October 17, 2009 at 11: 05 pm

    hi frosty
    on the mission poler bear cub one i am at the part with the yetti and the helocoptor and i can not get it so please help

  • 1090. catanya49  |  October 18, 2009 at 2: 14 am

    how do i get clothes that is for a member if im a non-member if you dont know please give me a website where i can find out !

    frosty: my god, you cant. i dont understand why everyone thinks that there are cheats on how to get member thigns or stars. thats unfair and cheating by the way, and there isnt any cheats for it nor will there ever be.

  • 1091. Kim  |  October 18, 2009 at 6: 53 pm

    can u check on fantage if im your friend my user is erinpaw 49

    plz plz plz plz plz awnser back

  • 1092. monique  |  October 21, 2009 at 3: 52 pm

    actually u can get members clothes but u get them with gems

    frosty: clothes you get with gems are always for everyone, they arent member clothes.

  • 1093. megamix  |  October 22, 2009 at 3: 57 pm

    Hey frosty whats ur dizzywood?

    frosty: uh…its frosty
    lol xD

  • 1094. monique  |  October 23, 2009 at 4: 29 am

    well i new that but diamonds r members and i have three of them i need membership!!!!!!!!!!!!!!!!!!!!!!!!!!!!

  • 1095. monique  |  October 23, 2009 at 3: 57 pm

    plus how come there is only one halloween game out

    frosty: well uh why would there have to be more? its not even time for the halloween party yet, and i dont get why you think there should be more.

  • 1096. Tara103  |  October 24, 2009 at 12: 53 am

    HOW DO YOU GET THE BLUE/PINK ICECREAM HAIR????

    P.S I AM A BIG FAN!!!!!! AND I AM USALLY ON AMBER ANTELOPE

    frosty: the icecream hair (pink for girls, blue for guys) are rare items. fidn them on my gems->items page.

  • 1097. monique  |  October 24, 2009 at 4: 20 pm

    meh me either i am wierd and thats me saying that

  • 1098. Ruby213  |  October 25, 2009 at 7: 25 am

    Frosty, How do you level up on Fantage??
    Please answer!

  • 1099. maplewood425  |  October 25, 2009 at 4: 29 pm

    I have a question frosty. ( actually 2 )

    #1: How many fantage halloween parties has fantage had?

    #2: I see people with cool wizard hats and cloaks, how do I get them?

    Please anser thanks!

    From,

    animalcrossingwi and or maplewood425

    frosty: 1. soon to be 2
    2. they are from a party back in july or august i think.

  • 1100. maplewood425  |  October 25, 2009 at 6: 37 pm

    OK Thank you for ansering!!!! I dont want to miss the next one in july or august ( i think its a party)

  • 1101. iz1330  |  October 25, 2009 at 9: 22 pm

    can you get the fish for me plz

    frosty: i tried getting them for you but when i did it never gave me them….so then i went and talked to the baby bear and it just had him in the center of the screen crying saying nothing. i think fantage is having issues, sorry.

  • 1102. Denise  |  October 26, 2009 at 1: 01 am

    im just wondering ummm… if u can visit my blog i just made it so yer… its a bit boring but meh anways…. heres the link

    http://sandy999sfantagecheats.blogspot.com/

  • 1103. egg_tart  |  October 26, 2009 at 4: 24 am

    I know how to make a website. Yola.com or iweb on Apple Computers Visit MyClubPenguinAdvise.yolasite.com

    Thx Egg_tart

  • 1104. monique  |  October 26, 2009 at 3: 17 pm

    frosty
    how do u get the big mountain type ghost it wont work plz tell mym minime

  • 1105. tissue45  |  October 26, 2009 at 5: 56 pm

    dear frosty i found all of the ghosts but is says that i still ned one more plzz help me

    frosty: click http://frosty1297.wordpress.com/2009/10/26/the-ghost-hunt/

  • 1106. ggjhgg  |  October 27, 2009 at 6: 24 pm

    can you give the anwser for the riddle tomorowcan you give the anwser for the riddle tomorow

  • 1107. stephie  |  October 27, 2009 at 8: 35 pm

    hey is there neway u can get a premium membership without having 2 pay(i mean like a cheat or something) btw, u know all the things u listed 4 rare items?(just rare, not very rare or ledgenary or nething) well, since im not a premium member i can only get those things right? but then i dnt even get all the things on that list and they said i already have everything 4 rare. r u sure those things r the things 4 rare?

    frosty: no, and read frequently asked questions.

  • 1108. monique  |  October 28, 2009 at 1: 15 am

    frosty where do u start riddles

  • 1109. cascada_987  |  October 28, 2009 at 2: 54 am

    how do u make a website

  • 1110. Anonymous  |  October 28, 2009 at 3: 38 pm

    yeah were do you start riddles

    frosty: click here

  • 1111. Anonymous  |  October 28, 2009 at 4: 29 pm

    I cant find one ghost why?

  • 1112. Ciara Reynolds  |  October 29, 2009 at 6: 30 pm

    frosty i was wondering on the be my buddy day wen u were gonna be buddies w/ any 1 i saw u downtown and was like oh hey frosty im a big fan of ur website and sed can we be buddies and u ran away. y?

  • 1113. Ciara Reynolds  |  October 29, 2009 at 6: 56 pm

    hey frosty i’m a big fan and i saw u on fantage and was like hey frosty im a huge fan can we be buddies and u ran away! y?

  • 1114. Ciara Reynolds  |  October 29, 2009 at 6: 57 pm

    hey frosty can u be my buddy? i asked u and u walked away

  • 1115. weam  |  October 29, 2009 at 9: 47 pm

    hey frosty how do you like your two year anniversary i hope its going awesome!

  • 1116. weam  |  October 29, 2009 at 9: 48 pm

    oh how many rare items can you get at the wizards domain?

  • 1117. weam  |  October 29, 2009 at 10: 31 pm

    ANSWER ANYTIME!

  • 1118. weam  |  October 30, 2009 at 11: 30 am

    where are all the ghosts on the trick or treat thingie plz plz help me

  • 1119. weam  |  October 30, 2009 at 12: 19 pm

    but quick

  • 1120. DisneyFairies09  |  October 30, 2009 at 2: 35 pm

    Hi frosty!
    what website did u use to make ur blog? did u have to pay? if so, how much?
    your half fantagian halp dizzywoodian friend,
    as known on Fantage, Miss DisneyFairies09,
    And as known on Dizzywood, Miss MalGal2000

    frosty: i used wordpress and its free.

  • 1121. DisneyFairies09  |  October 30, 2009 at 7: 21 pm

    Ok thanks! Do u wanna meet me sometime soon? not tryin to bug ya, just need friends. btw, on dizzy, r u a member?
    DisneyFairies09/MalGal2000

  • 1122. twilight_fan910  |  October 30, 2009 at 7: 53 pm

    frosty, Can you meet me on Purple Panda on Fantage? I want to be ur buddy. i will be at the carnival. also ur site has been really helpful to me for everything. my username is twilight_fan910. thanks! twilight_fan910

  • 1123. twilight_fan910  |  October 30, 2009 at 7: 56 pm

    frosty, Can you meet me on Plum Panther on Fantage? I want to be ur buddy. i will be at the carnival. also ur site has been really helpful to me for everything. my username is twilight_fan910. thanks! twilight_fan910

    P.S. My uncle helped make the charecters on dizzywood. lol no jk

  • 1124. sophie  |  October 30, 2009 at 10: 00 pm

    hi

  • 1125. Ciara Reynolds  |  October 30, 2009 at 11: 01 pm

    hey frosty!!!! i was wondering. wen ur membership expires and u renew it, do u lose all ur member stuff wen u becum a memebr agen?

    frosty: if you become a member again you get all your old member stuff back.

  • 1126. Ciara Reynolds  |  October 31, 2009 at 2: 08 pm

    awesum thx

  • 1127. InuHasha  |  October 31, 2009 at 6: 27 pm

    F
    Fa
    Fan
    Fant
    Fanta
    Fantag
    Fantage
    Fantage R
    Fantage Ro
    Fantage Roc
    Fantage Rock
    Fantage Rocks
    Fantage Rocks!
    Fantage Rocks
    Fantage Rock
    Fantage Roc
    Fantage Ro
    Fantage R
    Fantage
    Fantag
    Fanta
    Fant
    Fan
    Fa
    F

  • 1128. jacky79322 (fantage)  |  November 1, 2009 at 11: 48 am

    when do u get the medal from candy wizard?????????????????????????????????

  • 1129. janh  |  November 1, 2009 at 1: 44 pm

    hi frosty, i am janh on dizzywood and jellycat on fantage. i joined fantage a short while ago. i finished those trick or treat missions and other ones. i am building up a whole bunch of crystals .
    can u plz tell me wat combinations of crystals are for nonmembers?
    so far, i only got a pumpkin head and a skateboard. i know ur a member, but ur the only one i know to turn to.
    hope u had a great halloween.
    i really miss ur cheats on dizzywood.
    but i understand. janh or jellycat

  • 1130. Rose134  |  November 1, 2009 at 2: 41 pm

    Hi Frosty how do u get 300 points for the dw store?

    F
    FR
    FRO
    FROS
    FROST
    FROSTY
    FROSTY R
    FROSTY RU
    FROSTY RUL
    FROSTY RULE
    FROSTY RULES
    !FROSTY RULES!

    frosty: ???

  • 1131. xpinkpolkadotx  |  November 1, 2009 at 3: 17 pm

    OMG HEY FROSTY
    TO get a valentine dresss for fantage of course do you have to keep clicking activate cuz it dont work for me thankies
    please answer T.T

    Happy halloween

    -xpinkpolkadotx

    frosty: uh what? the valentine dress is an ultra rare item so you have to keep putting in gem combinations for ultra rare until you get it.

  • 1132. Im not telling  |  November 1, 2009 at 6: 00 pm

    DEAR FROSTY ALIEN! uhhhh i forgot… OH YA NOW I REMEMBER!!!!!!!!!!!!!!!!!!!!!!!!! Umm… HI!!!!!!! OK SO LIKE WHAT IS YOUR EASIEST WAY TO EARN STARS ON FANTAGE???? AND UMm IM like a member ok.. and i got all the rare stuff now wut? do i go on you tube??? lol

  • 1133. krissyiceice  |  November 1, 2009 at 10: 18 pm

    YO FROSTY!!!!!!!!!!!!!!!!!!! U ROCK!!!!!!!!!!!!! FROSTY ROX!!!!!!!! FROSTY ROX!!!!!!!!!! GO FROSTY!!!!!!!!!!!!!! YAY!!!!!!!!!!!!!!! ( lol )
    F
    FR
    FRO
    FROS
    FROST
    FROSTY
    R
    RO
    ROX
    !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

  • 1134. krissyiceice  |  November 1, 2009 at 10: 19 pm

    one question: how do u ppl get ur names to be green?

  • 1135. krissyiceice  |  November 1, 2009 at 10: 23 pm

    how do u ppl get ur names to be green?

  • 1136. krissyiceice  |  November 1, 2009 at 10: 25 pm

    whoops srry bout that.. guess my computer froze… SO SRRY

  • 1137. uurika  |  November 4, 2009 at 10: 20 pm

    omg omg omg omg

    when i saw ur comment i felt like a famous person just talked to me

  • 1138. Rainbow292  |  November 6, 2009 at 3: 56 pm

    How do I know when your own meebo? Do I just send you a message to tell you which time and place we meet?

    frosty: dont do times cuz ill probably forget, and its most likely we are in different timezones. if im online its say im online.

  • 1139. slushiebear  |  November 6, 2009 at 7: 10 pm

    hi frosty! remember me?
    so i have a few questions

    -how do you get that preppy outfit?
    (like the one with a tie and suit )

    -o and i tink thats about it :)

    can i meet you sometime on fantage?
    i accidentally deleted your friendship

    bye bye!!

    frosty: thats outfits from the back to school party, you cant get it anymore. and try to catch me on my meebo so we can meet again ^^

  • 1140. casie19  |  November 7, 2009 at 9: 38 pm

    Hey frosty i met u before long ways but i haven’t seen you till a long time.

    1.I have no idea that when u said they can fly and walking on walls i am having trouble with
    that can u help me?

    2. I have a weird cheat can i share it on your website?

    frosty: 1. i think fantage might have fixed the one i knew.
    2. sure?

  • 1141. casie19  |  November 7, 2009 at 9: 40 pm

    oh and plz commet!!!

  • 1142. seleny18  |  November 8, 2009 at 12: 28 pm

    frosty ihav a question
    how do u get those santa hairstyles like the santa hat with the secretary hair

    frosty: theyre from christmas.

  • 1143. seleny18  |  November 8, 2009 at 1: 44 pm

    froy on which server are u usually on becuz i would like to b one of ur buddies

  • 1144. seleny18  |  November 8, 2009 at 1: 45 pm

    i mean frosty

  • 1145. disneyfairies09  |  November 9, 2009 at 5: 21 pm

    hi frosty! what is the next contest??? plz tell me so i can win!

    /\-/\
    (o.o)
    ( O )
    /_\/_\ i know isn’t he cute?

  • 1146. Kaitlyn263(fantage)/breeanagirlcat(dizzywood)  |  November 11, 2009 at 3: 37 am

    hi frosty!!! I would like to be your friend on fantage please i love your site i think i also wrote a comment on the “dont go frosty” post i didnt want you to leave but you now u have fantage and i want to b ur friend on fantage and if you see me Kaitlyn263 on fantage please add or i will try to add you if i see you ok im a big fan i think my comment is like reeaalllyyyyy long so please add me and my question is:::Can we be friends on fantage?

    ~kait/bree

  • 1147. uurika  |  November 11, 2009 at 4: 24 pm

    Hi FROSTY

    it’s meh

    :P

  • 1148. minime1130  |  November 12, 2009 at 1: 50 am

    frosty my do members get EVERYTHING!!!!!!!!!!!!!!!!!!!

  • 1149. minime1130  |  November 12, 2009 at 1: 51 am

    frosty
    why do members get EVERYTHING!!!!!!!!!!!!!!!!!!!

    frosty: because they pay. circle of life.

  • 1150. Strawberryday  |  November 13, 2009 at 7: 05 am

    Who is xxCastawayxx? Is she ur friend in real life?

    frosty: no, just a friend online

  • 1151. Strawberryday  |  November 13, 2009 at 5: 32 pm

    Then why does do I see her comment like this: xxCastawayxx? Does she know your site password?

    frosty: ??? no

  • 1152. Rainbow292  |  November 13, 2009 at 11: 29 pm

    Can I send a friend request to you?

  • 1153. notmet  |  November 14, 2009 at 6: 11 pm

    plz how do u get the bee costume? i cant

  • 1154. Claudia1644  |  November 15, 2009 at 12: 44 am

    Hi Frosty.Nice site

  • 1155. omgmelol  |  November 15, 2009 at 1: 44 pm

    frosty how u get does t-shirt with a chirstmas three on theme

    frosty: uh its probably from christmas last year

  • 1156. tori  |  November 15, 2009 at 2: 05 pm

    can u get someone off you ignore list if you can how?

    frosty: yes just go to your buddy list, near the top of the box theres a tab that says ignore list. click that, click the person, and remove them off it.

  • 1157. miss chynia  |  November 15, 2009 at 3: 38 pm

    notmet- i know i’m not frosty, but the bee costume is for members and its diamond, diamond emerald. hope it helps.

  • 1158. puppydog  |  November 17, 2009 at 12: 37 pm

    hi well i think my question is can you meet me on fantage but also on clubpenguin how do you become an agent lots of my friends are agents and i just dont know how

  • 1159. Strawberryday  |  November 18, 2009 at 3: 22 am

    Hey Frosty,
    Just wondering,
    Do you reemember the time abotu a month or somthing ago when I met you on Fantage and somthign went a-wire becuase I could not see your speech, and I don’t think you could of seen mine. And I also want to say that ‘Animalcrossing’ comments on your site a alot and deserves a place on your best buddies page.

  • 1160. Frenchy64998  |  November 19, 2009 at 7: 54 pm

    hi frosty
    do u like taylor swifts new song …15
    cos i luv it
    any way
    the reson y im sending u somthing sooo late at night is because
    i liv in AUSTRALIA
    wat do u think of that?
    cool? awsome? weird?

    frosty: i love taylor swift, btu fifteens not a new song? and its not even 8…here. and a lot of people from all over visit so its not weird ^^

  • 1161. Frenchy64998  |  November 19, 2009 at 7: 55 pm

    well its not that late at night

  • 1162. misschynia  |  November 20, 2009 at 5: 56 pm

    Hey frosty
    i have a question for you!
    right now, what is your favorite song of the weeek?

    frosty: right now all the 3oh!3 songs are my favorites. i have a few ultimate ones i just keep listening to them all over and over. (13+)

  • 1163. xshiningstarx  |  November 20, 2009 at 6: 33 pm

    Hey frosty do you happen to like Miley Cyrus? I’m just asking for your opinion because I see some ppl going around saying that they hate Miley Cyrus…..

    frosty: i think its stupid to like/hate someone when you dont personally know them. so, no comment.

  • 1164. minime1130  |  November 23, 2009 at 2: 20 am

    frosty how would u like to know that i have done everything a NONMEMBER CAN DO

  • 1165. Puppydog  |  November 23, 2009 at 3: 52 pm

    HI frosty when you are on the winners page you see contest that have been on how do i know what contest are on and how to enter

  • 1166. daina36283  |  November 23, 2009 at 7: 24 pm

    tu sabes de Panamá?

    because I liv there
    i speak spanish and english

  • 1167. daina36283  |  November 23, 2009 at 7: 25 pm

    oh srry u know of panama?

  • 1168. daina36283  |  November 23, 2009 at 7: 27 pm

    oh srry frosty ok again
    u know of panama?
    is a little country but so beautiful
    i love it

  • 1169. daina36283  |  November 23, 2009 at 7: 29 pm

    LOL

  • 1170. daina36283  |  November 23, 2009 at 7: 30 pm

    L
    LO
    LOL
    LOLZ
    LOL
    LO
    L

  • 1171. peace!!!!  |  November 23, 2009 at 10: 14 pm

    hey!u must b pretty popular if u have lik 20 billion comments!!!!!i just found out bout u 2 day!:( i feel left out.sniffle sniffle.l8er

  • 1172. LilaSmiley  |  November 24, 2009 at 4: 52 pm

    Hey Frosty! Just a random thought: What kind of muffins do you like?

    frosty: all muffins!!

  • 1173. jian57  |  November 24, 2009 at 7: 46 pm

    how did u get the horse board ( i ment the board that has a horse on it )

    frosty: what?!?!?!

  • 1174. Trenton  |  November 24, 2009 at 10: 02 pm

    How do I become a member without paying?Also how do I make a lot of money?

    frosty: you dont, and you do what everyone else does to earn it

  • 1175. Blindeye52  |  November 25, 2009 at 8: 48 am

    frosty can u meet me on fantage?my username is blindeye52!

  • 1176. lollipopbuddy3  |  November 25, 2009 at 7: 08 pm

    hi frosty:)
    what game gives u the most stars?
    :) :):):):):):):):):):):):):):):):):):):):):):)

  • 1177. LilaSmiley  |  November 25, 2009 at 8: 30 pm

    Me again! ‘nother question: Are hobos cool (to you)? ‘Cause they are to me!

    frosty: i have no certain preferences on the way i opinionize hobo’s….

  • 1178. Pony93  |  November 26, 2009 at 7: 45 am

    Hey frosty where are the turkeys!!!??? ( for thanksgiving and hi from me pony93!)

    frosty: there in a lot of the rooms it doesnt matter though you dont get anything from them

  • 1179. xshiningstarx  |  November 26, 2009 at 10: 17 am

    O.O Good answer frosty…..good answer….btw are the turkeys you find for that indian girl the ones that are in the forest,carnival,and castle? Just wondering.

  • 1180. lollipopbuddy3  |  November 26, 2009 at 12: 24 pm

    frosty when does new rare stuff come out?

    frosty: idk?

  • 1181. LAILA223  |  November 26, 2009 at 12: 41 pm

    hey frosty can i meet you on dizzywood?today at one on wobbly at the cafe plz?
    you rock!(username is obvously laila223)

    frosty: uh i dont go on dw anymore

  • 1182. lollipopbuddy3  |  November 26, 2009 at 12: 56 pm

    frosty what is dizzywood?

    frosty: its…a…game…

  • 1183. elizabeth3658  |  November 26, 2009 at 2: 42 pm

    i like the song starstruk by 3oh!3 i saw in a eirlier comment you said you liked. ;)

    frosty: 3oh!3 has got to be one of my all-time fav bands i love all there songs. like every single one of them…

  • 1184. sasha_4u  |  November 26, 2009 at 3: 44 pm

    do u have lots of old accounts becuz i had a account and summ on stole i from me so
    i mad

    frosty: i have no old accounts on fantage, i dont think that far ahead.

  • 1185. LilaSmiley  |  November 26, 2009 at 3: 51 pm

    I love asking you random questions! I hope that doesnt annoy you…anyway…RANDOM THOUGHT: What socks would you want the most?

    I would want electric socks!!

  • 1186. lollipopbuddy3  |  November 26, 2009 at 4: 06 pm

    frosty
    i know this is a really weird question but what color is your hair?

    frosty: uhm idk how to explain it. its like a dark blonde but not brown…goldish. you’d have to see it its not really common.

  • 1187. Frenchy64998  |  November 26, 2009 at 10: 06 pm

    Hi its me!!!!!!!!!!!!!
    um
    do you like sway sway baby by short stack
    or ladies and gentlemen by short stack?
    if u dont know them its ok cos im not shore how popular they are!!!!!!!!!!
    :)
    hav you heard of 15 yet? (taylor swift)
    so yeah
    from frenchy64998

  • 1188. sasha_4u  |  November 26, 2009 at 11: 28 pm

    frosty
    how did u make this very own website
    its awesome!!!!

  • 1189. xshiningstarx  |  November 27, 2009 at 9: 51 pm

    Frosty I found this brainteaser on this website and I wanted to see if anyone could figure it out.

    I climbed up a cherry tree and there were cherries. I didn’t pick cherries and I never leaved cherries. Do you know how to explain this?

    frosty: uh. you ate them. piggy…

  • 1190. hallie136  |  November 28, 2009 at 3: 22 pm

    Frosty, Whats your favorite movie?

    frosty: …i…i dont know D:

  • 1191. xshiningstarx  |  November 28, 2009 at 3: 23 pm

    Well if I ate them that would’ve meant I picked cherries..you can try to guess again and not call me a piggy.

    frosty: the way you worded it makes it super confusing, because leaved isnt grammatically correct and its hurting my brain D:

  • 1192. xshiningstarx  |  November 28, 2009 at 5: 23 pm

    O_O I kinda didn’t notice i put the word leaved in there. ok ok let me say it again.

    I climbed up a cherry tree and there were cherries. I didn’t pick cherries. I never left cherries.

    There we go! Hope that’s a little better!

    frosty: my brain. its dieing. oh man ]:

  • 1193. xshiningstarx  |  November 28, 2009 at 5: 30 pm

    O.O I think I’m killing you.

  • 1194. spring786  |  November 28, 2009 at 8: 37 pm

    frosty is anyone ever mean to ya? does anyone ruin ur life on fantage or have they ever before?

    frosty: well yeah people are mean but i dont really care they dont really know me so they have no right to hate me or anything, but it doesnt bother me or ruin fantage for me.

  • 1195. Frenchy64998  |  November 28, 2009 at 8: 45 pm

    Hi Frosty
    wat do u think Australia looks like?
    And no its not like a desert
    just tell me wat u think it looks like

    frosty: hot dry surrounded by water bright nice

  • 1196. spring786  |  November 28, 2009 at 9: 25 pm

    omg frosty ur so awsome i wish i had so much self esteem as u! :)

  • 1197. animalcrossingwi  |  November 29, 2009 at 12: 00 pm

    i know this may be a bit strange…… but What are your favourite cookies & do u like pie?

    P.S.- PIE ROX MY SOX & COOKIES!

  • 1198. 12345678910meg  |  November 29, 2009 at 5: 11 pm

    Dear Frosty,

    I’m sorry for coping all your hard work.I just wanted more people to visit and to tell you the truth…I’m only 9 years old so I’m not a fast typer. I copied most of your things because I knew you were a fast typer so You could type more and…yhea.

    PLEASE FORGIVE ME (please advertise my site i swear i’ll erase all the stuff i copied.

    ~Meg

  • 1199. claudia1644  |  November 29, 2009 at 7: 39 pm

    Hi Frosty I have a question.How do you get the new Press Room Rookie medal on Fantage.

    BTW awesome site .I wish i could get my site as popular as this.
    U Rock Frosty :)

    frosty: i think you get it from doing reports.

  • 1200. xshiningstarx  |  November 29, 2009 at 8: 31 pm

    You know I could tell you the answer to the brainteaser if you want. O_O

  • 1201. elena  |  November 29, 2009 at 8: 33 pm

    how do u unable ignoring someone?

  • 1202. Lola  |  November 30, 2009 at 12: 09 am

    frosty somehow i got banned from a glitch i guess do u kno how to unbann someone?

    frosty: uh you cant. if you get banned its for a reason you shouldnt be able to play again.

  • 1203. smileh  |  December 2, 2009 at 4: 21 pm

    frosty, how did you get the snow falling on your blog home page? its really cool! :)

    frosty: …i didnt do anything…seriously

  • 1204. ashlie789  |  December 2, 2009 at 6: 55 pm

    i love fantage so much

  • 1205. xshiningstarx  |  December 2, 2009 at 8: 22 pm

    O.O Wait so u didn’t add the snow? WOW that’s freaky.

  • 1206. Bella  |  December 3, 2009 at 12: 06 am

    How can you become a beta and is there going to be any special christams items

    frosty: you cant anymore and yes

  • 1207. mjfan33  |  December 3, 2009 at 2: 45 am

    hey frosty when r u going on fantage again and where will you be go in emerald elephant on saturday 5th december meet u at creature place plz reply.

  • 1208. BETSY IS MY REAL NAME, IM 9  |  December 3, 2009 at 1: 46 pm

    CAN YOU GET ME A FREE PREMUIM ACCDOUNT PLZ IM BEGGING YOU AND BTW I AM 9
    frosty: no?!?!?! why would i ever pay $6 a month for someone i dont even know that probably has enough money to pay for it themselves. because im pretty sure everyone that has a computer can pay $6 for an online game membership if they really want it.

  • 1209. smileh  |  December 3, 2009 at 2: 48 pm

    Oh then the snow must be from the winter coming up…i saw the same snow on the wordpress.com homepage…:P

  • 1210. hallie136  |  December 3, 2009 at 3: 45 pm

    How do you get more levels on fantage? I have like 7 but i don’t even know how you get them get them?

  • 1211. hallie136  |  December 3, 2009 at 3: 46 pm

    How do you get more levels on fantage? I have like 7 but i don’t even know how you get them get them??

  • 1212. hallie136  |  December 3, 2009 at 3: 48 pm

    whoops sorry didn’t mean to put that twice. hah

  • 1213. xshiningstarx  |  December 3, 2009 at 6: 28 pm

    frosty u know loni rite? I was talking to her then wen i typed something it said i wasn’t her friend but wen i looked at my buddy list, she’s still there. Do u know wat’s happening??

    frosty: idk i happened to delete 8 buddies but it said i didnt so i had to log off and delete them again for it to work

  • 1214. Kim  |  December 3, 2009 at 8: 13 pm

    I cant wait till christmas!Can u?

  • 1215. Kim  |  December 3, 2009 at 11: 02 pm

    frosty do u know were any portals r on fantage?

  • 1216. LilaSmiley  |  December 4, 2009 at 9: 34 am

    What’s your favourite thing about Winter and the holiday seasons! I like meeting Santa o_O Just kidding!!

  • 1217. puppydog  |  December 4, 2009 at 4: 31 pm

    how do you enter your contests the ones on this website

  • 1218. sonamyforever  |  December 4, 2009 at 5: 53 pm

    I saw this girl named sive_4u and she had this really cute hot pink winter costume thing. the hod was on her head and it had blonde hair that was showing underneath the hood. it was a full body costume…do you know where i can get it? i am a premium member too. :)

    frosty: uhmm its a costume. try tthe costume shop idk if they have it anymore tho

  • 1219. dakotameaghan  |  December 4, 2009 at 6: 46 pm

    where do u get the santa dress????

    frosty: christmas last year

  • 1220. dakotameaghan  |  December 4, 2009 at 6: 55 pm

    where do u get the santa dress

  • 1221. iconic  |  December 4, 2009 at 8: 47 pm

    how do i put a POLL on my blog frosty?

    frosty: uh. well you make one (just look up like poll making site or something) then get the code and paste it in the html code part of a post//page

  • 1222. ellehcim2  |  December 4, 2009 at 9: 03 pm

    HI I was wondering if you knew how to get the christmas tree shirt on fantage?

    frosty: you cant its from last year. no holiday items for this month have been released yet this year.

  • 1223. ellehcim2  |  December 4, 2009 at 10: 52 pm

    ok

  • 1224. hcf01  |  December 5, 2009 at 1: 33 pm

    What did you do when you were a Beta Tester on Fantage and how do you become one??
    frosty: omigosh ive answered this question so many times. you can not become a beta tester, beta testers are those who played fanatge when it was first released and played it. they sort of “tested” the game like people test products to see if fantage would work, if it had glitches and problems, etc. after they release fantage to public when there ready beta testing ends. if you became a member during that first few months you are considered a beta tester.

  • 1225. hcf01  |  December 5, 2009 at 1: 36 pm

    How come the tab cheat to get into a full server doesn’t work anymore?

  • 1226. xshiningstarx  |  December 5, 2009 at 7: 39 pm

    they fixed the glitch hcf

  • 1227. hcf01  |  December 6, 2009 at 6: 08 pm

    Is there another glitch or cheat to get into full servers on Fantage???

    frosty: not right now…probably not ever

  • 1228. hcf01  |  December 6, 2009 at 6: 09 pm

    thx frosty and srry i asked you a question youve answered a million times.

  • 1229. nicole  |  December 7, 2009 at 4: 53 pm

    How do non members get accesories and i saw this you-tube video about how to get into a full-server but it never works do you know how to?

    frosty: nons get stuff from parties and the glitch to get into a full server was just fixed the other day. you can no longer log into a full server.

  • 1230. xshiningstarx  |  December 7, 2009 at 6: 16 pm

    :’( I’ll miss that glitch so much…

  • 1231. minime1130  |  December 8, 2009 at 4: 18 am

    frosty ur awesome and are there thing to do with christmas soon./

    frosty: thanks & yes

  • 1232. minime1130  |  December 8, 2009 at 3: 40 pm

    frosty is there a christmass thing on this year apart from the decorations?

    frosty: yes im pretty sure

  • 1233. odinfin  |  December 8, 2009 at 3: 53 pm

    Frosty! I searched this one thing and this came up! Go see it please.. I know that some people copy your work but they all give you your credit for it, but this person actually signed their name at the bottom!! This might just be a misunderstanding, but I think you should see it for yourself..

    Here’s the link:
    http://www.cheats4cp.com/index.php?option=com_content&view=article&id=50&Itemid=65

    frosty: &%(#*$*^!(& are you serious??? this is like the tenth dumb person ugh!

  • 1234. appleapple104  |  December 8, 2009 at 4: 34 pm

    wheres the mine? :(
    78

  • 1235. Bella  |  December 8, 2009 at 6: 10 pm

    Where do I play the game Boo?

    frosty: ?!?!?!?!?!?!?

  • 1236. Ponyo8  |  December 8, 2009 at 9: 12 pm

    Hey frosty how do i get the birthday hat? and how do i get 520989786785487645876589732958 stars because i saw someone have that much i think?

    frosty: its from a party you cant get it & i doubt you can ever get that much

  • 1237. minime1130  |  December 8, 2009 at 10: 03 pm

    ok i hope u know soon

  • 1238. Silly man  |  December 9, 2009 at 3: 58 pm

    Where Is The Concert??????

    frosty: vhat are you talking about??

  • 1239. Jennifer  |  December 9, 2009 at 10: 06 pm

    Hi Frosty I was wondering about the gems thing
    i know there is more stuffs then what i have for gems but it say that i already used that combination so i was wondering where is the “FAQ” button located to find out what is wrong
    PLEASE respond THNAKYOU:)
    -Jennifer

    frosty: the FAQ’s are on the gems->items page under the lists of items you can get. there in green & pink before the comments

  • 1240. Bella  |  December 10, 2009 at 4: 32 pm

    Hellppp!!! Im a non member and I just took the quiz today, right? Well i passed and I went and got my camera icon but it won’t show up! Oh y god i am so frustrated right now frosty, help!

    frosty: try logging out tehn back in. it should be on the top of ur screen. big camera, says “reporter”

  • 1241. Dee  |  December 10, 2009 at 8: 38 pm

    frosty how do u fly and how do u get more stars

  • 1242. bday  |  December 10, 2009 at 9: 20 pm

    hey frosty i just got the snowman costume do u have it and i like your website and can u help me i need more money on fantage jkjkjk lol hahahehe write back

  • 1243. maplewood425  |  December 11, 2009 at 1: 57 pm

    What do you like wearing on Fantage the most?

  • 1244. sasha_4u  |  December 11, 2009 at 6: 19 pm

    OK UMM DO U BELIEVA IN SANTA CLAUS CUS
    ITS DUMB HOW A FAT MAN COULD FIT IN A CHIMMNY AND REIN DEERS CANT FLY!!! :i

    frosty: he’s magical, obviously ;]

  • 1245. sasha_4u  |  December 11, 2009 at 6: 21 pm

    THE NO SHOES GLITCH DOESNT WORK ANY MORE!!!

  • 1246. sherley739  |  December 12, 2009 at 12: 44 am

    CAN YOU HELP ME WIN FIRST PLACE ON COMET FANART PLZ PLZ PRETTY PPLZ

  • 1247. xshiningstarx  |  December 12, 2009 at 9: 43 am

    lolz of course he’s magical its ok if u dont believe in magic. :D

  • 1248. liltaye  |  December 12, 2009 at 7: 34 pm

    can u visit my site and comment good ways to improve?

  • 1249. sasha_4u  |  December 12, 2009 at 8: 31 pm

    omg this girl on fantage got an member account in havent payed for it i know cuzz shes my friend!!

  • 1250. sasha_4u  |  December 12, 2009 at 8: 34 pm

    omg this girl on fantage got an member account in havent payed for it i know cuzz shes my friend!! did u pay for urs cuz im confused and its dangerous to me cuz she didnt even pay comment plzz frosty
    >:(

  • 1251. sasha_4u  |  December 12, 2009 at 8: 35 pm

    ughh im so confuesd

  • 1252. sasha_4u  |  December 12, 2009 at 8: 36 pm

    frosty wat is url cuz idk wat it is

  • 1253. jennifer  |  December 12, 2009 at 11: 01 pm

    how do u get into full servers now it would let u even if u do the tab enter thing

  • 1254. fantagebestfriends  |  December 13, 2009 at 10: 45 am

    Frosty how do you take picture and make them not white around?

  • 1255. animalcrossingwi  |  December 13, 2009 at 12: 21 pm

    WHERE DID WADDLEZ GO??? DID HE QUIT??? ;D DONT TELL ME HE QUIT??

  • 1256. egg_tart  |  December 13, 2009 at 3: 35 pm

    I think he did but I dunno

  • 1257. egg_tart  |  December 13, 2009 at 3: 40 pm

    hey frosty… do u play sims 2?

  • 1258. egg_tart  |  December 13, 2009 at 3: 43 pm

    and I quit my website – its abandoned so u better not go there it hasn’t been updated lol

  • 1259. egg_tart  |  December 13, 2009 at 4: 28 pm

    how do you change your pic?? I wanna change the screaming monster I have lol

  • 1260. sasha_4u  |  December 13, 2009 at 7: 42 pm

    frosty kk this is a long story this girl on fantage is like gimccount on my person s3ndy_ 333 and i said noo and she kept beggin aand beggin and she does this to any member her name is molly she onutube to and illwrite it down after i find it im going to fo this relly quick and i write it down no lies so members watch out cuz she did it to me and got band for it all but she was no all ways band watch out ppeeps…….members peeps cuz she wants ur accounts byes

  • 1261. sasha_4u  |  December 13, 2009 at 7: 55 pm

    kk its called fantage account scandel..yay!i found it watch plzzz frosty comment plzz

  • 1262. sasha_4u  |  December 14, 2009 at 5: 55 pm

    frosty what kind of payment did u do for ur membership cus for christmas im getting one YAY!! and if u get the one for 6 dollars u have to pay every month like EVERY!!
    PLZZZ REPLY:SASHA_4U
    a.k.a shannah45102
    other persons name
    plzzz comment
    thx bye :)

    frosty: you pay $6 for a monthly membership, but if you or yours guardians dont cancel it you will keep getting billed for every month you have it i think. you can also get 6 months and a year but idk if you could keep interest that long. if you get a gamecard of them its for like 2-4 months. idk how much it costs though

  • 1263. xshiningstarx  |  December 14, 2009 at 6: 13 pm

    i used the gamecard with the 20$ on it

  • 1264. Strawberryday  |  December 14, 2009 at 6: 13 pm

    Frosty!! The cheats4fantage website copied all of your pages! This person is onyl 9 and i av warned her that it is possible to go to jail! She has copied all of her pages and had signed her name at the bottom! SHE COPIED EVERYTHING! She says that ur her idol so if u tell her on her site she might stop! But you could take legal action, but ur nice and i doubt u would but you shoudl warn her!!!!

    frosty: i have warned her, many times actually. she always says she’ll get rid of them but she never does D: and i dont want to take legal action over something little silly and stupid that can be changed in a second like this. but she is really bugging me.

  • 1265. sasha_4u  |  December 14, 2009 at 8: 13 pm

    all you people whose asking frosty for her frist letter of her pass get ur own accounts and leave that girl alone
    shannah45102

  • 1266. sasha_4u  |  December 14, 2009 at 8: 21 pm

    thx for telling me about the game card…im going to do t right now…in pay it for christmas

  • 1267. lildani  |  December 16, 2009 at 10: 20 am

    Hi frosty! I am lildanica on fantage and lildani`s blog is my blog! Is it OK with you if I use some pics from your site?

    frosty: id really rather you didnt

  • 1268. lildani  |  December 16, 2009 at 10: 37 am

    F
    FR
    FRO
    FROS
    FROST
    FROSTY
    FROSTY I
    FROSTY IS
    FROSTY IS A
    FROSTY IS AW
    FROSTY IS AWE
    FROSTY ISW AWES
    FROSTY IS AWESO
    FROSTY IS AWESOM
    FROSTY IS AWESOME!

  • 1269. tigers101  |  December 16, 2009 at 11: 14 am

    how long have you been on fantage and how did you find out about it?

    frosty: uhm since like march 2008 i think? idk how i found out about it

  • 1270. amandaroks77  |  December 16, 2009 at 12: 21 pm

    HEY PEEPS I LOVE FANTAGE………. how long have all of you been on fantage.com?
    i have been on 4 5 months!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

  • 1271. sasha_4u  |  December 16, 2009 at 5: 32 pm

    frosty how to be a member for 1 day??
    plzz reply shannah45102

    frosty: you cant, you dont.

  • 1272. claudia1644  |  December 16, 2009 at 5: 32 pm

    Hey Frosty can you add me to your blogroll i added you.It’s alright if u say no.The web address is http://www.claudia1644.wordpress.com

    frosty: i only add people i know that wont be using me for more views. so i cant sorry

  • 1273. sasha_4u  |  December 16, 2009 at 7: 46 pm

    kk but frosty let me show u summin im finna do it right now

  • 1274. sasha_4u  |  December 16, 2009 at 8: 00 pm

    dang couldnt

  • 1275. claudia1644  |  December 16, 2009 at 9: 37 pm

    alright but it wasnt for the viewers I would never use you like that.
    and btw your site rocks frosty

  • 1276. hcf01  |  December 17, 2009 at 12: 28 pm

    I know amandaroks77 and tigers101 in real life. We all LOVE fantage SO much!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

  • 1277. tigers101  |  December 17, 2009 at 12: 33 pm

    i love to write coments to you and im friends with amandaroks77 and hcf01 in real life. and u seem really nice.

  • 1278. tigers101  |  December 17, 2009 at 12: 34 pm

    what is the latest cheat

  • 1279. carly36595  |  December 17, 2009 at 5: 06 pm

    how do i reset mt missions?????? PLEASE TELL ME ????? PLEASE????????

    frosty: …you contact fantage and tell them what the problem is with your mission and theyll restart it for you

  • 1280. hallie136  |  December 18, 2009 at 7: 52 pm

    What do you want for Christmas?

  • 1281. Shanti  |  December 19, 2009 at 12: 55 am

    Hi frosty whats up?I have an account on fantage and I was wondering if you were on Mt.Fantage Please send me the answer Sincerly Shaley1793

  • 1282. frosty__roks  |  December 19, 2009 at 9: 34 am

    hi frosty,
    i just wanted to ask you that if this has been happening to you,
    i just can’t move sometimes on fantage and i can’t click on non members and i can only click on myself and members.
    my friend she has a fantage account that is not working too she can’t click on herself and other people.the last thing is my account and my friend’s account we have a members level like the medals you have to become a member but now i don’t know why which is why i am asking you that what is wrong with fantage or me?please answer my questions
    frosty: im pretty sure its just a glitch. ive been having trouble clicking on anybodys IDfone including myself and all members. and the medals that are gray dont show up unless your a member, its just another thing that members get that make non-members want it so they become members and get fanatge more money.

  • 1283. tigers101  |  December 19, 2009 at 7: 12 pm

    frosty, sometimes member girls are mean to me. No offence to you. but what should i do?

    frosty: …i cant control peoples meanness. and just because there a member doesnt mean it makes them mean, thats just who they are. obviously if there are mean people on an online game then there just stupid and jerks, they should know better. but mean people are everywhere you just have to deal with it and laugh at them :[ sorry tiger

  • 1284. nelly  |  December 19, 2009 at 7: 14 pm

    dear frosty
    iam having diffullcuties clinking on myself and i can only be friend with premium members and it takes a long time to load

  • 1285. supersonic1001  |  December 20, 2009 at 1: 01 pm

    Dear Frosty,what server do you usually go on on fantage? I would be happy to meet you! thanks!!!!!

    frosty: uhm well i havent been going on much but i usually go on plum panther, peach puma, or maroon moose.

  • 1286. supersonic1001  |  December 20, 2009 at 1: 03 pm

    F
    FR
    FRO
    FROS
    FROST
    FROSTY
    FROSTY R
    FROSTY RO
    FROSTY ROX!

  • 1287. sasha_4u  |  December 20, 2009 at 7: 17 pm

    weird frosty kk im on level 7 and 2 days ago i was on level 86 and if u kno anything plzz comment and if u have somethin suspicius with it plzz comment and if happend to u…plzzz comment and if u havee sumthing to say welll……pllzzz comment lolz
    shannah45102

    frosty:…did u become a member?

  • 1288. sasha_4u  |  December 20, 2009 at 7: 22 pm

    on youtube 1 day of member is true its a hack i seen it with my own eyes!! the guy posted it

    frosty: its probably fake.

  • 1289. sasha_4u  |  December 21, 2009 at 7: 05 am

    no it didnt have the member medal on m id phoneits like i was am nonmember thats been on fantage for the longest and i had all these diff clothes i was fellin lucky!

  • 1290. sassy_pipper123  |  December 21, 2009 at 5: 41 pm

    frosty didnt u take all things u got from fantage??
    on ur home page so when u tell people not to takre ur stuff from the home page it actually fantages things

    frosty: yes but fantage is a kid site. they make it so it doesnt matter if you copy their posts because they know that young kids will do it. they never make a big deal about it at all.

  • 1291. sassy_pipper123  |  December 21, 2009 at 5: 45 pm

    in u can go to jail taking others people s things..exspecially known games on ur computers it true so dont try to excuse it plzzz or try to say u cant cuz umm.. u can

  • 1292. emma gau  |  December 21, 2009 at 9: 20 pm

    do you know cheats to the ginger house xD

  • 1293. lollies22  |  December 21, 2009 at 9: 23 pm

    hey frosty where is santas cottage and also
    where do you get your picture taken with santa?
    p.s i love you you are awesome

    frosty: uhm i dont think thats out yet

  • 1294. Strawberryday  |  December 22, 2009 at 2: 11 pm

    Frosty? I want ti make a website but i want it in the serch engines. Is ur free? Do u pay for ur blog website thing????? PLEASE REPLY FROSTY!!! PPPPPLLLLLLLEEEEEEEAAAAASSSSSSEEEE!!!

    frosty: mines free, its really easy you just go to wordpress.com (thats how i made mine) and it basically does evrything for you except make your posts and ideas ^^

  • 1295. maplewood425  |  December 22, 2009 at 5: 03 pm

    how did u get your site so popluar ?

    frosty: its been a long time ._. i never advertised or anything…i guess i just must have shown up on peoples search engines and they liked meh blog ^.^

  • 1296. minime1130  |  December 22, 2009 at 6: 23 pm

    how do you use 2x star coupons?

    frosty: you go to a game that has the 2x coupon symbol then at the right hand side when you enter the game (dont play it yet) theres an option to use them you click it then click redeem coupon or buy coupons or whatevr there.

  • 1297. trizia  |  December 22, 2009 at 11: 25 pm

    how do u restart a mission when it doesnt say restart on the page?

    frosty: ive answered this so many times, just look on the page and find one of the people who always asks the same question as you and the answers there.

  • 1298. minime1130  |  December 22, 2009 at 11: 31 pm

    thanks frosty’

  • 1299. minime1130  |  December 23, 2009 at 3: 58 am

    thanks

  • 1300. allyssd  |  December 23, 2009 at 10: 39 am

    1:what surver are you usally on in fantage

    2:can we be friends on fantage

    3:can i be your worker on this blog

    frosty: 1. i dont have a certain server
    2. sure?
    3. no.

  • 1301. allyssd  |  December 23, 2009 at 10: 47 am

    one more thing frosty can you go on fantage decmber 25 5:00

    on maroon mooce and plz pleaseeeee write it down!!!!!!!!!!!!!!!!!!!!!

    frosty: i dotn know what time zone your in and i probably wont be home.

  • 1302. allyssd  |  December 23, 2009 at 10: 51 am

    and meet me at the light house and you can go on my person

    user name:allyssd

    no capadols

  • 1303. jikorox  |  December 23, 2009 at 3: 32 pm

    i know a really EASY WAY TO MAKE LOTS OF STARS!!!!! i think u play buzzer beater if ur good at it right?

  • 1304. jikorox  |  December 23, 2009 at 3: 34 pm

    how do u make starS?

  • 1305. lovely_wolf  |  December 23, 2009 at 3: 59 pm

    wat three gems do u need to get the rare item it shows on the blog on fantage?

    frosty; explain the outfit please

  • 1306. ilikeflowers  |  December 23, 2009 at 8: 47 pm

    can u give me a dizzywood silver or gold acc plzz

    frosty: no.

  • 1307. Prisila_boo  |  December 23, 2009 at 10: 57 pm

    How can you get in the window of creature area (Where You Buy the creatures In fantage) (:

    Thanks- Prisila Martinez

    frosty: im not sure how, i dont even know if its possible.

  • 1308. Prisila_boo  |  December 24, 2009 at 4: 26 pm

    Please Could You answer my question >.<
    ~ Frosty ??

  • 1309. →☆ⓛⓘⓝⓓⓐ★←  |  December 24, 2009 at 9: 31 pm

    hey prisila…. i know how to get into the window….but today i tried it and it didnt work so theres no use for it….. :(

  • 1310. →☆ⓛⓘⓝⓓⓐ★←  |  December 24, 2009 at 9: 37 pm

    oh wait! i still works! i just tried it…. and i got in the window… idk why it didnt work today?…..?o.O?

  • 1311. →☆ⓛⓘⓝⓓⓐ★←  |  December 24, 2009 at 9: 41 pm

    frosty if you want send me an email and ill send you a pic of the glitch if you dont already know how… dont worry i wont spam ur email… im am %100 trustable… :D … but you dont have to… im just sayin…

  • 1312. najika2000  |  December 25, 2009 at 9: 28 am

    ok frosty just wondering do you go on thes sites:?

    starrdoll.com

    clubpenguin.com

    neopets.com

    p.s. i’m chinese what r u?

  • 1313. xshiningstarx  |  December 26, 2009 at 5: 00 pm

    omg i used to go on neopets.com all the time but then i got bored of it so i didnt play it anymore.

  • 1314. Prisila_boo  |  December 26, 2009 at 8: 29 pm

    Thanks but can i know how to get up there?
    (:

  • 1315. tigers101  |  December 30, 2009 at 10: 12 pm

    hey frosty i was wondering if u knew any cheats that r fun to use

    can u answer quick?

    frosty: ??

  • 1316. everardo52  |  December 31, 2009 at 4: 10 pm

    where is another friend?????????

    frosty: not out yet

  • 1317. clare  |  December 31, 2009 at 6: 47 pm

    where did u get the 2010 thing and how

    frosty: i posted this like 3 times but they are rare, you get them from wizards domain. its a rare combination.

  • 1318. Fantagefan  |  December 31, 2009 at 9: 43 pm

    hey frosty. I just found a cheat/glitch. The glitch/cheat is that if you keep on answering the comic things and keep on pressing get sticker you will get lots of that sticker like ex. I played and answered it 3 times so i got the 3 stickers so please post this glitch/cheat.

  • 1319. Jennifer  |  December 31, 2009 at 11: 43 pm

    How cum we aren’t allowed to make punctuations on fantage like :) ??? plz answer!!!

    frosty: idk D:

  • 1320. Jennifer  |  January 1, 2010 at 12: 39 am

    Y dont u knoe??? i want to know!! i c ppl do the puncutations like that all the time but wen i ask them, they leave! ;(

    frosty: you can get them from the safe chat word bubble things

  • 1321. red  |  January 1, 2010 at 7: 36 am

    can we be friends?

Leave a Comment

hidden

Some HTML allowed:
<a href="" title=""> <abbr title=""> <acronym title=""> <b> <blockquote cite=""> <cite> <code> <pre> <del datetime=""> <em> <i> <q cite=""> <strike> <strong>

Trackback this post  |  Subscribe to the comments via RSS Feed